KEGG   Prunus persica (peach): 18783305Help
Entry
18783305          CDS       T03092                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pper  Prunus persica (peach)
Pathway
pper00250  Alanine, aspartate and glutamate metabolism
pper00410  beta-Alanine metabolism
pper00430  Taurine and hypotaurine metabolism
pper00650  Butanoate metabolism
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
Module
pper_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    18783305
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    18783305
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    18783305
   00430 Taurine and hypotaurine metabolism
    18783305
Enzymes [BR:pper01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     18783305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18783305
NCBI-ProteinID: XP_007215454
UniProt: M5X548
LinkDB All DBs
Position
G3
AA seq 503 aa AA seqDB search
MVLSKTASESDVSVHSTFASRYVRTSLPRFKMAENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMASINKNYVDMDEYPVTTELQNRCVNIIAHLFNAPLEDSESAVG
VGTVGSSEAIMLAGLAFKRKWQNKRRAEGKPIDNPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCRENMIVLKEGLEK
TERFNIVSKDEGVPLVAFSLRDNHRHDEFEISDLLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSHTLAERLVNDIQKVLHELDTLPSKLSSNVKAADGEDGKPAETRALESKKSDLEK
TREITTIWRKFVTARKQKMNVVC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttctctcaaagactgcttcggagtcggatgtctctgtccactcaaccttcgcttct
cgatatgttcgaacttctctccccagattcaaaatggcggaaaactcgatccccaaggag
gcagcgtaccagatcataaacgacgagcttatgttggacggcaacccgaggctgaatctg
gcgtcgttcgtgaccacatggatggagcctgagtgcgataaactgatgatggcctccatc
aacaagaactacgtggacatggatgaataccctgtcaccactgagctccagaatcggtgc
gtaaacatcatagctcatctcttcaatgccccattggaggattcagagtccgcagttgga
gtgggaactgtgggctcttctgaagccatcatgttggccggcttagctttcaagaggaag
tggcagaacaagaggagagctgagggcaagcccattgacaaccccaacattgtcaccgga
gccaatgtccaggtgtgctgggagaaatttgcaaggtactttgaggtggagttgaaggag
gtgaagttgagggaaggatactatgtaatggaccctgagaaagcagtggagatggttgat
gagaacaccatctgcgtcgctgctatccttggctccactctcaatggagaattcgaagat
gttaagcgcctgaatgatctcttggtagagaagaacaaggaaactggatgggatactcca
atccatgtagacgcagcaagtggtgggtttattgcaccatttctgtacccagaacttgag
tgggacttccgtttgcccttagtgaagagcatcaatgttagtgggcacaagtacggactt
gtgtatgcaggaattgggtgggtcatctggaggaacaaagaggacttgcctgaggaactc
atcttccatatcaactatcttggagcagatcaacctaccttcaccctcaacttctctaaa
ggttccagccaagttattgctcaatattatcaactgattcgcttgggttttgaggggtac
aggaatgtcatggaaaactgtcgtgaaaacatgatagtactaaaagaaggattggagaag
acagagcgcttcaacatagtctctaaagacgaaggggtaccattagtggccttctctttg
agggacaaccaccgccatgacgagttcgaaatctctgacttgcttcgccgcttcggatgg
attgtccctgcctacaccatgcctccagatgcgcaacatgtcacagttttgcgcgtggtg
attagagaagacttctctcacactttggcggagcgcctagtgaatgatatccagaaagtg
ttgcatgaactagacacacttccatctaagcttagctctaatgtgaaggctgccgacgga
gaggatgggaaacctgcagagacgagggcacttgagagtaagaagagtgatttggaaaag
acaagggagatcacaacaatttggaggaagtttgttacggccaggaagcagaagatgaat
gttgtttgttag

DBGET integrated database retrieval system