KEGG   Prunus persica (peach): 18783492Help
Entry
18783492          CDS       T03092                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pper  Prunus persica (peach)
Pathway
pper00630  Glyoxylate and dicarboxylate metabolism
pper00710  Carbon fixation in photosynthetic organisms
pper01100  Metabolic pathways
pper01200  Carbon metabolism
Module
pper_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pper_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pper_M00532  Photorespiration
pper_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    18783492
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    18783492
Enzymes [BR:pper01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     18783492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 18783492
NCBI-ProteinID: XP_007215051
UniProt: M5XB14
LinkDB All DBs
Position
G3
AA seq 183 aa AA seqDB search
MASSMISSATVASVYADRAAPAQASLVAPFTGLKSASAFPGAKKTNDITSIASNGGRVQC
MKVWPTVGLKKFETLSYLPPLSPESLAKEVDYLLRKNWVPCLEFELEKGFVYRENHRSPG
YYDGRYWTMWKLPMFGCTDSSQVLKELEEAKKANPNSFIRIIGFDNVRQVQCISFIAYKP
AGY
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccatgatttcttcagctaccgtggcttcggtttacgctgaccgtgccgcc
ccggcacaagctagcttggttgcaccattcactggcctcaagtctgcctcagctttcccc
ggcgccaagaagaccaatgacatcacctccattgcaagcaatggtggaagagtgcaatgc
atgaaggtgtggcctacagttggactgaagaagttcgagactctctcctaccttccacca
ctctctcctgagtctttggccaaggaagtagactaccttctccgcaagaactgggttccc
tgcttggaatttgagttggagaagggatttgtgtaccgtgagaaccacaggtcaccaggg
tactatgatggaaggtactggaccatgtggaagctgcccatgtttggatgcacagactct
tcccaagtgttgaaagagctcgaggaggccaagaaggctaaccccaactctttcatccgt
atcatcggattcgacaacgttcgtcaagtgcagtgcatcagtttcatcgcctacaagcct
gcaggctactaa

DBGET integrated database retrieval system