KEGG   Prunus persica (peach): 18789616Help
Entry
18789616          CDS       T03092                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pper  Prunus persica (peach)
Pathway
pper00010  Glycolysis / Gluconeogenesis
pper00053  Ascorbate and aldarate metabolism
pper00071  Fatty acid degradation
pper00280  Valine, leucine and isoleucine degradation
pper00310  Lysine degradation
pper00330  Arginine and proline metabolism
pper00340  Histidine metabolism
pper00380  Tryptophan metabolism
pper00410  beta-Alanine metabolism
pper00561  Glycerolipid metabolism
pper00620  Pyruvate metabolism
pper00903  Limonene and pinene degradation
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18789616
   00053 Ascorbate and aldarate metabolism
    18789616
   00620 Pyruvate metabolism
    18789616
  09103 Lipid metabolism
   00071 Fatty acid degradation
    18789616
   00561 Glycerolipid metabolism
    18789616
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    18789616
   00310 Lysine degradation
    18789616
   00330 Arginine and proline metabolism
    18789616
   00340 Histidine metabolism
    18789616
   00380 Tryptophan metabolism
    18789616
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    18789616
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    18789616
Enzymes [BR:pper01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     18789616
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 18789616
NCBI-ProteinID: XP_007221800
UniProt: M5XAM9
LinkDB All DBs
Position
G1
AA seq 534 aa AA seqDB search
MASRRVSSVLSRSFTSASLFSAGRSSSVARGIGKYSTDASFEAPIIPSVKVNYTRLLING
QFVDAASGKTFPTLDPRTGNVIAHVAEGDSEDINRAVSAARKAFDEGPWPKMTAYERSRV
LFRFADLVEKHNDEIATLETWDNGKPFEQAAKTEVPMIVRFFRYYAGFADKIHGLTVPAD
GEYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVAPALACGNTVVLKTAEQTPLSALYVATL
LQEAGLPPGVLNVVSGFGPTAGAALCSHMEVDKVAFTGSTDTGKKVLELAAKSNLKTVTL
ELGGKSPFIVCEDADVDKAVELAHFALFFNMGQCCCSGSRTFVHERVYDEFIEKARARAE
KRIVGDPFKGGVEQGPQIDSDQFEKILRYIDYGIKSGATLETGGGRLGTKGFYIKPTVFS
NVKDDMPIAQDEIFGPVQSILKYKDLDEVIRRANTTRYGLAAGVFTQNIDTANTLTRALR
VGSVWINCFDVFDAAIPFGGYKMSGHGREKGIYGLSNYLQVKAIVTPLKNPAWL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctcggagggtctcttcggttctgtctcgttcattcacatctgcttctctgttt
tctgcagggaggtcttcttctgtggctagaggaattggtaaatatagcactgatgcttca
tttgaggcaccaatcattccatccgttaaagtaaattatactcggcttctaattaatgga
caatttgtagatgcagcatcagggaaaacttttcccacattggacccccgaactgggaat
gtgattgctcatgttgctgaaggcgattctgaagatataaatcgggcagtttctgctgcc
cgcaaggcctttgatgaaggaccatggccaaagatgacagcttatgaaagatcaagggtc
cttttccgctttgctgatttggttgaaaagcataatgatgaaattgcaacccttgagact
tgggataatgggaagccatttgaacaggctgctaaaactgaagtaccaatgattgtgcgt
tttttccggtactatgctggatttgcggataagattcatggtctcacagttccagctgat
ggagagtatcatgtgcaaaccttgcatgaacctataggtgttgcaggtcagataattcca
tggaatttccctcttctcatgtttgcttggaaggttgcgcctgccttagcatgtggcaac
accgttgttctgaagacagcagagcagacaccattgtctgctctatatgtagcaacgctg
ttgcaggaggctggacttcctccaggtgttttaaatgtggtttcaggttttggtccaact
gccggtgcagcgctttgtagtcatatggaagttgataaggttgcttttactggatcaact
gataccggcaaaaaagtactagaattggctgccaaaagcaatcttaagactgtaactttg
gagcttggcgggaaatccccatttattgtgtgtgaggatgctgatgtagataaggctgtt
gagctggcacactttgctttattctttaatatgggtcaatgctgctgttctggttctcgt
acatttgtgcatgaaagagtatatgatgagttcatagagaaagcaagggcccgtgctgag
aaacgcattgttggtgatccattcaaggggggtgttgagcaaggtcctcagattgattca
gaccaatttgagaagatcctgaggtacatagattatggtattaaaagtggagctacactg
gaaactggaggagggaggcttggcacaaagggtttctatattaagcccactgtattctca
aatgttaaggatgacatgccaatagcacaggatgagatttttggtccagtgcagtccatc
ttgaaatacaaggaccttgatgaggtgataagaagggcaaatactacgcgatacgggctt
gctgcaggggtcttcacacaaaacatagatactgcaaacacattgacacgtgcattgcgg
gtcggtagtgtatggataaactgctttgatgtctttgatgctgcaattccttttggaggg
tacaagatgagtggacatggaagagaaaagggcatttatggtctttctaattacttgcaa
gttaaggctattgtcacgcccctgaaaaatcctgcatggctataa

DBGET integrated database retrieval system