KEGG   Prunus persica (peach): 18791076Help
Entry
18791076          CDS       T03092                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pper  Prunus persica (peach)
Pathway
pper00010  Glycolysis / Gluconeogenesis
pper00020  Citrate cycle (TCA cycle)
pper00620  Pyruvate metabolism
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
pper01200  Carbon metabolism
Module
pper_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18791076
   00020 Citrate cycle (TCA cycle)
    18791076
   00620 Pyruvate metabolism
    18791076
Enzymes [BR:pper01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     18791076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 18791076
NCBI-ProteinID: XP_007222612
UniProt: M5XEC1
LinkDB All DBs
Position
G1
AA seq 484 aa AA seqDB search
MASSPFLSKTTISFSSSISPSLPWRSSHSSPSFSTAFRTKPRRRTLTVQSKIREIFMPAL
SSTMTEGKIVSWVKSEGDVLSKGESVVVVESDKADMDVETFYDGILAAIVVGEGETAPVG
AAIGLLAETEEEVAEAKAKAKSASSDSPASSSPAAEAVTPTPPPATSTPAPAIAQPSPPA
TYTPKKTVATPFAKKLAKQHKVDIASVVGSGPFGRITPADVEAAAGIAQPKKTVAAEPTP
VSAAPPKPSAAPSASSAPLLPGSTVVPFTTMQAAVSKNMLESLSVPTFRVGYPISTDALD
ALYEKVKPKGVTMTALLAKAAALALAQHPVVNASCKDGKSFTYNSSINIAVAVAVNGGLI
TPVLQDADKLDLYLLSQKWKELVEKARAKQLQPHEYSSGTFTLSNLGMFGVDRFDAILPP
GQGAIIAVGASKPTVVADADGFFSVKSKMLVNVTADHRIVYGADLAAFLKTFAKIVENPE
SLTL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttctccatttctatctaagaccaccatttccttctcctcctccatctccccc
tctcttccctggcggtcctcacactcttccccttccttctccaccgcatttcgcactaaa
ccccgtcggagaaccctgaccgtccaatccaagatcagggagatcttcatgcctgccctc
agctccaccatgaccgagggaaagatcgtctcctgggtcaaatccgaaggcgacgtcctc
tccaaaggcgagagcgtcgtcgtcgtcgagtccgacaaggccgacatggacgtcgagacc
ttctacgacggaattctcgccgccatcgtcgtcggcgagggtgagaccgcccctgtcgga
gccgccatcggactactggccgagaccgaagaggaagtcgccgaggctaaagccaaagcc
aaatccgcttcatcagattcccccgcttcttcttccccggctgctgaagctgttacgccc
actcctcctcctgctacttccactcccgctccagctatcgcccagccttctccacctgct
acttacactcccaaaaagactgtggccacgccttttgccaaaaagctagccaagcaacac
aaggtggacattgcctccgtggtgggctccggcccatttggccgaattacacctgctgat
gtggaggccgccgccggaattgcccagcccaagaaaaccgtcgccgccgagcccactccc
gtgtccgctgctccacccaagccttctgctgctccttcggcttcatcagcgcctctgctt
cctggctcaaccgtggtgcccttcacaacgatgcaggccgccgtttcgaagaacatgttg
gagagtctctcggtgccaacattccgcgttggttatccaatcagcaccgacgcgctcgat
gccctctacgagaaggtgaagccaaagggtgtgaccatgactgcattgttggccaaggcc
gctgctctggcactcgctcagcacccggttgtaaatgccagctgcaaagacggaaagagc
ttcacgtataatagtagcataaacatcgccgttgctgtggcagtcaatggtggccttata
acccctgttcttcaggatgccgataagttggatttgtatttgttatcccagaaatggaaa
gagctagtggagaaggcccgtgcgaagcaacttcagccccatgagtacagttcaggaact
ttcactttgtccaatttgggcatgtttggagtggacagatttgatgctattcttcctcca
ggacagggggctatcattgctgttggagcttcaaagccaaccgttgtggccgatgcagat
gggttcttcagtgtaaaaagtaaaatgctggtaaatgtaacagctgatcaccggattgtt
tatggtgctgatttggctgccttcctcaagacgtttgcaaagattgttgagaacccagag
agcctcacgttgtag

DBGET integrated database retrieval system