KEGG   Prunus persica (peach): 18792370Help
Entry
18792370          CDS       T03092                                 

Definition
(RefSeq) hexokinase-2, chloroplastic isoform X2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pper  Prunus persica (peach)
Pathway
pper00010  Glycolysis / Gluconeogenesis
pper00051  Fructose and mannose metabolism
pper00052  Galactose metabolism
pper00500  Starch and sucrose metabolism
pper00520  Amino sugar and nucleotide sugar metabolism
pper01100  Metabolic pathways
pper01110  Biosynthesis of secondary metabolites
pper01200  Carbon metabolism
Module
pper_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pper_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18792370
   00051 Fructose and mannose metabolism
    18792370
   00052 Galactose metabolism
    18792370
   00500 Starch and sucrose metabolism
    18792370
   00520 Amino sugar and nucleotide sugar metabolism
    18792370
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    18792370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pper04131]
    18792370
Enzymes [BR:pper01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     18792370
Membrane trafficking [BR:pper04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    18792370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 18792370
NCBI-ProteinID: XP_007222247
UniProt: M5XDB5
LinkDB All DBs
Position
G1
AA seq 481 aa AA seqDB search
MSVAATPPAVGPFYLRRRSPSTAMSMPRFRMAVRSAAVSVTPLLTKLHNDSATPLPLLRH
VADAMAADMRAGLAVDGGSDLKMILSYVDSLPSGNEEGLFYALDLGGTNFRVLRVQLGGK
QERVIATEFDQQLFDFIASGLAKFAQKEGNKFHLPTGTKREIGFTFSFPVKQTSIDSGIL
IKWTKGFSVSGTAGKDVVACLNEAMERRGLDMRVSALINDAVGTLAGARYWDDDVMVAVI
LGTGTNACYVERADAIPKLQGQVSSSGRTIINTEWGAFSDGLPLTEFDREMDAASINPGE
QIFEKTISGMYLGEIVRRVLVKMAEADALFGESVPEKLSTPFALRTPDICAMQQDISDDL
QDVGSILYNVAGVESNLSARKIVVDVCDTVVKRGGRLAGAGIVGILQKMEEDSKGLIFGK
RTVVAMDGGLYENYPQYRRYLQEAVTELLGTEISKNVVIEHSKDGSGIGAALLAAANSQY
A
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttgctgccacgcccccagccgttggacctttctacctcaggcgccgatcacct
agtacggccatgtccatgcctcgctttaggatggccgtccgatctgctgccgtttctgtc
actccgctgttgaccaagctacacaacgactctgccactcctttgcccctcctgcgccac
gtggcagacgccatggccgccgacatgcgagccgggcttgccgtggatggtgggagtgac
ctcaagatgatactcagctatgttgacagcctcccaagcgggaatgaggaggggttgttt
tatgcactggatcttggaggcacaaacttcagggtgctgagggtacaactaggcggcaaa
caagagcgtgtgattgccaccgaattcgaccagcaactgtttgatttcattgcttctggg
ctggcaaaatttgcacaaaaagagggtaataaattccaccttccaaccggtacaaaaagg
gagattggattcacattttcatttcctgtgaagcagacctccattgactctggcatacta
attaagtggacaaagggtttttctgtttctggaacggcagggaaagatgtggttgcttgt
ttgaatgaggctatggaaaggcggggacttgatatgcgggtgtctgccctgattaatgat
gcggttggaacattagctggagcaagatattgggatgatgatgtcatggttgctgttata
ttgggtactggaaccaatgcttgctatgttgaacgggcagatgctatcccgaaactacag
ggtcaggtttcttcttctggcagaacgattattaacactgagtggggagcattctcagat
ggtcttcctttgactgaatttgatagagaaatggatgctgctagtatcaatcctggtgag
cagatctttgagaaaacaatttctggaatgtatctgggtgaaattgtacgaagagtgtta
gtgaagatggctgaagcagatgctttgtttggtgaatctgtcccagaaaaactatcaaca
ccttttgcactcaggaccccagatatatgtgctatgcagcaagatatatctgatgacctt
caagatgttggatcaatcctatacaatgtagcaggggttgagtcaaatctaagtgcaaga
aagattgtggtggatgtatgtgacaccgtcgtgaagcgaggtgggcgcttagctggtgca
ggaatagtagggatacttcaaaagatggaggaggattcaaaaggtctcatctttggcaag
aggacagtggtggcaatggatggagggttgtatgaaaactatcctcaatacagaagatat
ttgcaagaggcagtgacagagcttcttgggacagagatttcaaagaatgtggtcatagaa
cattcaaaagatgggtctggcataggggctgctctcttggctgctgcaaattcccagtat
gcataa

DBGET integrated database retrieval system