KEGG   Prunus persica (peach): 18794033Help
Entry
18794033          CDS       T03092                                 

Definition
(RefSeq) probable glutathione S-transferase parA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pper  Prunus persica (peach)
Pathway
pper00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    18794033
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pper02000]
    18794033
Enzymes [BR:pper01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     18794033
Transporters [BR:pper02000]
 Other Transporters
  Pores ion channels [TC:1]
   18794033
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C_2 GST_N_2 GST_C GST_C_6 GST_C_5
Motif
Other DBs
NCBI-GeneID: 18794033
NCBI-ProteinID: XP_007226335
UniProt: M5XNN8
LinkDB All DBs
Position
G1
AA seq 222 aa AA seqDB search
MDEDEVVLLGFWTSPYVMRVKIALAEKGVHYYYMEEGNLFKNKSTLLLKMNPVFKKVPVI
IHNDKSICESLIILQYIDDVWNDRAPILSEDPYQRAKARFWIDFFDKKMADCGRRMWASK
GADQEAAKKEFIESLKLLEGELGEKPYFEGDRFGLLDIALVPFSCRFYTYETLCNFSVEK
ECPKLIEWVKRCSLRESVSKSLPDQYKVYDFVLEFKKMLGIN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggatgaagtggtgcttttggggttctggactagtccttatgtcatgagagtg
aaaattgctttggcagagaagggagtccactactactatatggaagaaggaaatcttttc
aagaataagagcactttgcttctgaaaatgaacccagtgtttaagaaagttccagttatc
atccataatgataagtccatttgtgaatccctcatcatccttcaatacattgatgatgtt
tggaatgacagagctccaatactttcagaggatccttatcagcgagctaaagcaaggttt
tggattgatttttttgacaagaagatggcagactgtgggagaaggatgtgggctagcaag
ggagcagaccaagaggcagcaaagaaagagttcatagaaagcttgaagctgttagaaggc
gagcttggagagaagccctactttgaaggcgatcgcttcggcctcttggatattgccctg
gtaccattctcttgcaggttttacacatatgagactctttgcaatttcagcgtagagaaa
gagtgccccaagctcatcgagtgggtgaaaaggtgcagtctgagggagagtgtttccaag
agccttcctgaccaatataaagtctatgactttgtgttggaattcaagaaaatgcttgga
attaattag

DBGET integrated database retrieval system