KEGG   Prunus persica (peach): 9978733Help
Entry
9978733           CDS       T03092                                 

Gene name
rbcL, PrpeC_p029
Definition
(RefSeq) ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pper  Prunus persica (peach)
Pathway
pper00630  Glyoxylate and dicarboxylate metabolism
pper00710  Carbon fixation in photosynthetic organisms
pper01100  Metabolic pathways
pper01200  Carbon metabolism
Module
pper_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pper_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pper_M00532  Photorespiration
pper_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pper00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    9978733 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    9978733 (rbcL)
Enzymes [BR:pper01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     9978733 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 9978733
NCBI-ProteinID: YP_004021673
UniProt: E3W0K1
LinkDB All DBs
Position
CP
AA seq 475 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEESQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREITLGFVDLLRDDFVEKDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREASKWSPELAAACEIWKEIKFEFQAMDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagattat
aaattgacttattatactcctgactatgaaaccaaagatactgatatcttggcagcattt
cgagtaactcctcaacctggagttccacctgaagaagcaggggcagcggtagctgctgaa
tcttctactggtacatggacaactgtatggactgacgggcttactagtcttgatcgttac
aaaggtcgatgctaccacatcgagcccgttgctggagaagaaagtcaatttattgcttat
gtagcttaccccttagacctttttgaagagggttctgttactaacatgtttacttccatt
gtaggtaatgtgtttgggttcaaggccctgcgcgctctacgtctggaggatttgcgaatc
cctcctgcttatgttaaaactttccaaggcccgcctcatgggatccaagttgagagagat
aaattgaacaagtatggccgccccctattgggatgtactattaaacctaaattggggtta
tccgctaagaattacggtagagcagtttatgaatgtctccgcggtggacttgattttacc
aaagatgatgagaatgttaattcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagcaatttataaagcacaggctgaaacaggtgaaatcaaagggcattacttg
aacgctactgcaggtacatgcgaagagatgatcaaaagagctgtatttgccagagaattg
ggggttcctatcgtaatgcatgattacttaacagggggattcactgcaaatactagcttg
gctcattattgccgagataatggtttacttcttcacatccaccgtgcaatgcatgcagtt
attgatagacagaagaatcatggtatgcactttcgtgtactagctaaagcgttacgtatg
tctggtggagatcatatacacgctggtaccgtagtaggtaaacttgagggggaaagggag
atcactttaggctttgttgatttactacgtgatgattttgttgaaaaagatcgaagccgc
ggtatttatttcactcaagattgggtctctttgccaggtgttttgcctgtagcttcaggg
ggtattcacgtttggcatatgcctgctctgaccgagatctttggagatgattctgtacta
caatttggcggcggaactttaggacacccttggggaaatgcacctggtgccgtagctaat
cgagtagctctagaagcatgtgtacaagctcgtaatgagggacgtgatcttgctcgtgag
ggtaatgaaattattcgcgaggctagtaaatggagtcctgaactagctgctgcttgtgaa
atatggaaggagatcaaatttgaattccaagcaatggatactttgtaa

DBGET integrated database retrieval system