KEGG   Pseudomonas putida F1: Pput_4038Help
Entry
Pput_4038         CDS       T00537                                 

Definition
(GenBank) cobalamin-5'-phosphate synthase
  KO
K02233  adenosylcobinamide-GDP ribazoletransferase [EC:2.7.8.26]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00860  Porphyrin and chlorophyll metabolism
ppf01100  Metabolic pathways
Module
ppf_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pput_4038
Enzymes [BR:ppf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.26  adenosylcobinamide-GDP ribazoletransferase
     Pput_4038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobS
Motif
Other DBs
NCBI-ProteinID: ABQ80162
UniProt: A5W7Q2
LinkDB All DBs
Position
complement(4554801..4555523)
Genome map
AA seq 240 aa AA seqDB search
MLPFWIALQFLSSLPVSLPGMPAPREVGRSLLYYPLVGLLFGLLLWLASHLLQGTPSPLH
AALLLTLWVLLSGALHLDGLADSADAWLGGFGDRERTLRIMKDPRSGPIAVVTLVLVLLL
KFCALWVLVGQGIGAQLLLAPLIGRAAMLGLFLGTPYVRPGGLGQALAEHLPRRAAGWVL
LVCVLFCLFLGGWSVLLALAVFAWLRHLMCRRLGGTTGDTAGALLELLELAVVLGLALGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgttctggatcgccctgcaatttctcagcagcctgccggtgagcctgccgggc
atgccggcaccgcgtgaggtagggcgttcgctgctgtactacccgctggtcgggttgctg
ttcggcttgctgctgtggttggccagtcatctgcttcagggcacgccgtcgccgctgcac
gcggctttgctgctgacactgtgggtactgctcagtggtgccttgcacctggatggcctg
gcggacagtgccgacgcctggctaggtggtttcggcgaccgtgagcgcaccttgcggatc
atgaaagacccgcgcagtgggccgattgccgtggtcaccctggtcttggtgttgttgctg
aagttttgcgcattgtgggtgctggtcgggcagggcatcggcgcgcaattactgctggcg
ccgttgatcgggcgggcggcgatgttgggcctgttccttggcacaccttatgtgcgacct
ggcgggttgggccaggcgttggccgaacatttgccccggcgcgcggcggggtgggtgttg
ctggtttgtgtgctgttctgcctcttcttgggcggatggagcgtgctgctggcgctggcg
gtgtttgcctggttgcggcatctgatgtgccggcgcctgggcgggaccaccggtgatacc
gccggtgcgttgctggagctgctggagctggccgtcgtgctcgggttggcgctggggctt
tga

DBGET integrated database retrieval system