KEGG   Pseudomonas putida F1: Pput_5240Help
Entry
Pput_5240         CDS       T00537                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00010  Glycolysis / Gluconeogenesis
ppf01100  Metabolic pathways
ppf01110  Biosynthesis of secondary metabolites
ppf01120  Microbial metabolism in diverse environments
ppf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pput_5240
Enzymes [BR:ppf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Pput_5240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABQ81358
UniProt: A5WB48
LinkDB All DBs
Position
5884381..5885277
Genome map
AA seq 298 aa AA seqDB search
MATFQVVTEQHGELNCWRISSDRAELLIAQQGAQVLSYQQVGEPPLLWLSDQAIFRQGKS
VRAGVPVCWPWFGNLQRNPEAVQAMYQGTPAPAHGLARTRDWKLLGIKEVGETLRIEFEL
PEARGDLPGWPHDVELKLVVEMGADLTLSLTSRNMGNTPVTISQALHSYFAVSDVRQARV
EGVDGLGYIETLAGWEQRQQQGALTFAGETDRIYLNTPQTLSIVDPHWNRRITLTSSGSR
STVIWNPWTERAKDLADMADDGWQRMLCIETANVWDDLVELKPGASHSLGVQIGCENI
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggctacctttcaggtcgtaaccgagcaacatggcgaactcaactgctggcgtatcagc
agtgaccgtgccgaactcctgatcgcccagcagggcgcacaggtcctcagctaccagcag
gtgggcgaaccgccactgctgtggctgagcgaccaggccatcttccgccagggcaagtcg
gtacgcgccggggtaccggtgtgctggccatggtttggcaacctgcagcgcaaccctgag
gccgtccaggccatgtaccagggaacaccggcgcctgcccacgggcttgcgcgcacgcgt
gactggaaattgctgggtatcaaagaagtgggcgagaccctgcggatcgagttcgaactg
cctgaagcgcggggcgacctgcccggttggccccatgatgtcgagctgaaactggtggtg
gagatgggcgcagacctgacactgagcctgaccagccgcaacatgggcaatacccccgtg
accatcagccaggccctgcatagctacttcgcggtcagcgatgtgcgccaggcgcgggtc
gagggtgtcgacgggctgggttatatcgaaaccctggcgggctgggaacaacgccagcag
cagggggcactgacgtttgccggggagacggaccgaatctacctgaacaccccgcagacc
ctcagcatcgtcgacccgcattggaatcggcggattaccttgaccagcagcggctcgcgc
tcgacggtgatctggaacccgtggaccgagcgagccaaagacttggcggacatggctgat
gatggctggcagcggatgttgtgcatcgagacggcgaatgtgtgggatgacctggtggag
ttgaagcctggggcgagtcattcgctgggcgtccagatcggttgtgaaaatatctga

DBGET integrated database retrieval system