KEGG   Pseudomonas putida GB-1: PputGB1_0938Help
Entry
PputGB1_0938      CDS       T00650                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00970  Aminoacyl-tRNA biosynthesis
ppg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PputGB1_0938
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ppg03029]
    PputGB1_0938
Enzymes [BR:ppg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PputGB1_0938
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PputGB1_0938
Mitochondrial biogenesis [BR:ppg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PputGB1_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ABY96848
UniProt: B0KQG0
LinkDB All DBs
Position
complement(1076286..1077737)
Genome map
AA seq 483 aa AA seqDB search
MHQFTLAEIARGLADKSFSSEELTRALLARIKQLDPQINSFISVTEDLALGQARAADARR
AAGETGALLGAPIAHKDLFCTNGVRTSCGSKMLDNFKAPYDATVVAKLAEAGMVTLGKTN
MDEFAMGSANESSHYGAVKNPWNLEHVPGGSSGGSAAAVAARLLPATTGTDTGGSIRQPA
ALTNLTGLKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCALLLQGMAGFDAKDSTSIEE
PVPDYSANLNASLQGLRIGLPKEYFGAGLDPRIAELVQASVKELEKLGAVVKEISLPNMQ
HAIPAYYVIAPAEASSNLSRFDGVRFGYRCEEPKDLTDLYKRSRGEGFGVEVQRRIMVGT
YALSAGYYDAYYVKAQQIRRLIKNDFMAAFNDVDLILGPTTPNPAWKLGAKSSDPVAAYL
EDVYTINANLAGLPGLSMPAGFVDGLPVGVQLLAPYFQEGRLLNVAHRYQQVTDWHTRAP
NGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaatttaccctggccgagatcgcccgcggactcgccgacaaatcgttttcttcc
gaagagctgacccgcgcgctgctggcgcgcatcaaacagctcgacccgcagatcaacagc
ttcatcagcgtcaccgaagacctggccctgggccaggcacgtgccgccgacgcccgtcgc
gccgctggcgaaaccggcgcgctgctgggggcgccgatcgcccacaaagacctgttctgc
accaacggcgtacgcaccagctgcggctcgaagatgctcgacaacttcaaggcgccgtat
gacgccaccgtggtcgccaagctggccgaagccggcatggtcaccctgggcaagaccaac
atggacgaattcgccatgggttcggccaacgagtccagccactacggcgcggtgaagaac
ccgtggaacctcgagcacgtacccggcggctcgtccggtggctcggccgctgcagtggcc
gcgcgcctgctgcccgccaccaccggtaccgacaccggcggctcgatccgccagccagct
gcactgaccaacctcaccggcctcaagccgacgtacggtcgtgtgtcgcgctggggcatg
atcgcctacgcctccagcctcgaccagggcggcccgctggcccgcaccgccgaggactgc
gccctgctgctgcaaggcatggccggtttcgacgccaaggactccaccagcatcgaagag
ccggtgccggactacagcgccaacctgaacgcttcgctgcagggcctgcgcatcggcctg
ccgaaagagtactttggcgcaggcctcgacccacgcatcgccgaactggtccaggccagc
gtcaaggagctggaaaagctcggtgcggtggtcaaggaaatcagcctgccgaacatgcag
cacgccatcccggcctactacgtgatcgccccggctgaagcctcttccaacctgtcgcgc
ttcgacggcgtgcgcttcggctaccgctgcgaggagcccaaagacctcaccgacctgtac
aagcgttcccgcggcgaaggcttcggcgttgaagtacagcgccgcatcatggtcggcacc
tacgcgctgtcggcgggctactacgacgcctactacgtgaaggcgcagcaaatccgccgc
ctgatcaagaacgacttcatggccgccttcaacgatgtcgacctgatcctcggcccgacc
acgccaaacccggcctggaagctcggcgccaagagcagcgacccggtcgccgcctacctg
gaagacgtctacaccatcaacgccaacctggcgggcctgccgggcctgtcgatgcccgct
ggcttcgtcgacggcctgccagtcggcgtgcaactgctggcgccgtacttccaggaaggc
cgcttgctcaacgtcgcgcaccgctaccagcaagtgaccgactggcacacccgcgccccc
aacggcttctga

DBGET integrated database retrieval system