KEGG   Pseudomonas putida GB-1: PputGB1_1608Help
Entry
PputGB1_1608      CDS       T00650                                 

Definition
(GenBank) putative RNA methylase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
ppg  Pseudomonas putida GB-1
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppg03009]
    PputGB1_1608
Enzymes [BR:ppg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     PputGB1_1608
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     PputGB1_1608
Ribosome biogenesis [BR:ppg03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PputGB1_1608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_24 Methyltransf_11 Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: ABY97513
UniProt: B0KG92
LinkDB All DBs
Position
1815311..1817503
Genome map
AA seq 730 aa AA seqDB search
MSDRFELYLTCPKGLEGLLAEEAKGLGLEEVREHTSAIRGAADMETAYRLCVWSRLANRV
LLVLKRFSMKNADDLYDGVNAVDWADHLAADGTLAVEFSGHGSGIDNTHFGALKVKDAIV
DKLRNREGLRPSVEKIDPDVRVHLRLDRGEAILSLDLSGHSLHQRGYRLQQGAAPLKENL
AAAVLIRSGWPRIAAEGGALADPMCGVGTFLVEAAMIAADIAPNLKRERWGFSAWLGHVP
ALWRKVHDEAQARAQAGLAKPPLWIRGYEADPRLIQPGRNNVERAGLGDWVKIYQGEVST
FEPRPDQNQKGLVISNPPYGERLGDEASLLYLYQNLGERLRQACMGWEAAVFTGAPQLGK
RMGIRSHKQYAFWNGALPCKLLLFKVQPDQFVTGERREAQPEGTEVRQQAPQASEPARLS
EGAQMFANRLQKNLKQLGKWARREQIDCYRLYDADMPEYALAVDLYQDWVHVQEYAAPRS
IDPDKAQARLLDALAAIPQALGISPQRVVLKRRERQSGTRQYERQATEGRFQEVNEGGVK
LLVNLTDYLDTGLFLDHRPMRMRIQREAAGKRFLNLFCYTATATVHAAKGGARSTTSVDL
SKTYLDWARRNLALNGYSERNRLEQSDVMAWLEGNRDSYDLIFIDPPTFSNSKRMEGVFD
VQRDHVQLLDLAMARLAPGGVLYFSNNFRKFQLDEHLMARYAVEEITAQTLDPDFARNNR
IHRAWRLQLR
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccgtttcgaactttatctcacctgccctaaaggccttgaaggcctgcttgcc
gaagaggccaagggccttggccttgaagaggtgcgcgagcacacctcggccattcgcggc
gccgccgacatggaaaccgcctaccgcctgtgcgtatggtctcgcctggccaaccgggta
ctgttggtactcaagcgcttcagcatgaagaacgccgatgacctttacgatggcgtcaat
gccgtcgactgggccgaccacctggcggctgacggcacgctggcggttgaattcagcggc
catggctcgggcatcgacaacacccacttcggtgcgctgaaggtcaaggatgcgatcgtc
gacaagctgcgcaatcgcgagggcctgcgcccgtcggtggaaaagatcgacccggacgtg
cgcgtgcacctgcgcctggaccgcggcgaggccatcctctccctcgacctgtccggccac
agcctgcaccagcgtggctaccgcctgcagcagggcgccgcgccattgaaagaaaacctg
gcggcagcggtgttgatccgttccggctggccgcgcattgccgccgaaggcggcgcactg
gccgacccgatgtgcggcgtgggtaccttcctggtcgaggcggcgatgatcgctgccgac
atcgcccccaacctcaaacgtgaacgctggggcttcagtgcctggctcggccacgtgccg
gcgttgtggcgcaaggtgcatgacgaagcgcaggcccgcgcgcaggctggcctcgccaag
ccacctctgtggatccgtggctacgaggccgacccgcggctgatccagccgggccgcaac
aacgtcgagcgtgccggcctgggcgactgggtgaagatctaccagggcgaagtcagcacg
ttcgagccacgcccggaccagaaccagaaaggcctggtcatcagtaacccgccctacggc
gagcgtctgggtgacgaggccagcctgctgtacctctaccagaacctcggcgagcgcctg
cgccaggcttgcatgggctgggaggcggcggtgttcaccggcgcaccgcagctgggcaag
cgcatgggtattcgcagccacaagcaatacgcgttctggaacggcgccttgccgtgcaag
ctgttgctgttcaaggtgcagcctgaccagttcgtcactggcgaacgccgtgaggcgcag
cctgaaggcaccgaagtccgccagcaggccccgcaggccagcgagccggcgcggctgtcg
gaaggggcgcagatgtttgccaatcgcctgcagaaaaacctcaagcaactgggcaagtgg
gcccgtcgcgagcagatcgactgctaccgcctgtacgatgccgacatgcccgaatatgcc
ctggcggtcgacctgtaccaggactgggtccatgtgcaggagtacgctgcgccacgttcg
atcgacccggacaaggcccaggcccgcctgctcgatgcgctggcggctatcccgcaggcg
ctgggcatttcgccgcaacgtgtggtgctcaaacgacgcgagcgccagagcggcacgcgc
cagtatgagcgccaggcgaccgagggccgtttccaggaggtcaacgaaggtggcgtcaag
ttgctggtcaaccttaccgactacctcgatacagggctgttcctcgaccaccgcccgatg
cgcatgcgcattcagcgcgaagcggccggcaagcgcttcctcaacttgttctgctacacc
gccacggccaccgtgcatgcggccaagggcggtgcgcgcagcaccaccagtgtcgacttg
tcgaaaacctacctggactgggcacggcgcaacctggcgctcaatggctactccgagcgc
aaccgccttgagcagagcgatgtgatggcctggctggaaggtaaccgcgacagctacgac
ctgatcttcatcgacccgccaaccttctccaactccaaacgcatggaaggcgtgttcgac
gtgcagcgtgaccatgtgcaactgctggacctggccatggcccgcctggcaccgggcggc
gtgctgtatttctccaacaacttccgcaagttccagttggacgagcatctgatggcacgt
tatgccgtggaggaaatcaccgcccagacgctggacccggactttgcccgtaacaaccgg
atccaccgcgcctggcgcctgcaattgcgttga

DBGET integrated database retrieval system