KEGG   Pseudomonas putida GB-1: PputGB1_2635Help
Entry
PputGB1_2635      CDS       T00650                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PputGB1_2635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppg03400]
    PputGB1_2635
Enzymes [BR:ppg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PputGB1_2635
DNA repair and recombination proteins [BR:ppg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PputGB1_2635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ABY98534
UniProt: B0KSK9
LinkDB All DBs
Position
2951369..2953870
Genome map
AA seq 833 aa AA seqDB search
MAKPLQEYARKRDFSATPEPDGRRSRGKQAHALLFCIQKHDASHLHYDFRLELDGTLKSW
AIPKGPSLDPKVRRLAVHVEDHPLDYADFEGHIPEGHYGAGDVIVWDRGIWEPEGDAREA
YAKGKLRFRLQGEKLSGVWNLFRTHLAGKKEQWMLVKSHDGQARSEADYSIVEAQPDSVL
SDRTLLPRKAAAKKATTPRTNRQRTGKGQHAPLPAQLQPQLATLVDSPPSGDWRYEVKFD
GYRIMARIDGEDIRLFTRNGHDWSSKMPRQVAALRALGVGSAWLDGEMVVVDENGAADFQ
ALQNAFDTEHDEGIAYYLFDLPFLGGRDLRQVPLQGRRDTLRQLLGHDESDVLKFSADFD
QPVESLLDSACRLQLEGLIGKRVDSPYSGRRSSDWVKLKCKQRQEFVIVGYTDPKGSRSG
FGALLLALHDNDSGELRYAGKVGTGFSDTTLATLLARLTSLETAKPAVARPPTGAEARGV
HWLQPKLLAEVAYAQMTRDGIVRHSVFHGLRDDKAATAIDLERAMPAKTVPKRSKQAKTS
ETPDELHLTHPDRVIDATLGATKREVAEYYADISQWILPQLKHRPVALVRAPDGLAGELF
FQKNAGQLHIPNVLSYEKAEAGQAAMVINRPDTLLGAVQMNMLELHTWNATDKDFDKPDR
FVLDLDPDPALPWKAMLEATQLTLTLLDELGLKVFLKTSGGKGIHVVVPLTRRAGWDEVK
GFSHAIVNYLATLFPDRLSAVSGPKNRVGRIFIDYLRNSKGATTACAYSLRAREGLPVSV
PIWREELVQLKAANTWNIANVRERLAAVEDPWADLGKVRQSITARMRKQLGLS
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcccctgcaggaatatgcgcgcaagcgtgacttcagcgccacgcccgagcca
gacggcaggcgcagccgtggtaaacaggcccacgccctgctgttctgcatccagaagcat
gacgccagccacctgcactatgacttccgcctggagcttgatggcaccctgaagagctgg
gcgatccccaaggggccgtcgctggaccccaaggtgcgccgactggccgtgcatgtggag
gaccatccgctggactacgccgacttcgaggggcatatccccgaaggccactatggtgca
ggcgatgtgatcgtttgggaccgtggcatatgggagcccgagggcgatgcccgtgaggct
tatgccaaaggcaagctgcgctttcgcctgcagggtgaaaagctcagtggtgtgtggaac
ctgtttcgcacccacctggccggcaaaaaggagcaatggatgctggtgaagtcccacgat
ggccaggcgcgcagcgaagctgactacagcattgtcgaggcccagcctgacagcgtgctc
agcgaccgcaccttgttgccacgcaaggccgctgcaaaaaaggccactacaccgcgcacc
aaccgtcaacgcaccggaaaaggccagcatgcgccgttgccagcgcagctacagccgcag
cttgcaacgttggtggattccccgcctagcggcgactggcgctatgaagtcaagttcgac
ggctaccgcatcatggcccgcatcgacggcgaagatatccgcctgttcacccgcaatggc
cacgactggagcagcaaaatgccccggcaggtcgctgccttgcgcgcgctgggtgtcggt
tcggcctggctcgacggcgaaatggtggtggttgacgaaaatggcgcagcagacttccaa
gccttgcagaacgccttcgataccgagcatgacgaaggcattgcctattacctgttcgac
ctgccgtttcttggtggtcgggacctgcgtcaggtaccgctgcagggccgccgcgacacc
ttgcgccaactgcttgggcacgatgagtcggacgtactcaagttttctgccgactttgac
cagcctgtcgaatccctgctcgacagcgcctgccgtctgcagctcgaagggctgatcggc
aaacgcgtcgacagcccgtacagtggccgccgcagctcggactgggtcaagctcaagtgc
aagcaacgccaggaattcgtgatcgtcggctacaccgaccccaaaggcagccgcagcggc
ttcggggccttgctgctggctctgcacgacaacgacagtggtgagctgcgctatgccgga
aaggtaggtaccggcttcagtgataccaccctggccaccctgcttgcccggttgacgtct
ctggaaactgccaagccagccgtggccaggccgcccaccggtgccgaagcccgtggtgtg
cattggctgcaaccgaaactgctcgctgaagtcgcctatgcccagatgacccgtgatggc
atcgtacgccactcggttttccacggcctgcgcgacgacaaggcggcaacagctatcgac
ctggagcgcgccatgcccgccaagaccgtgcctaagcgcagcaagcaggccaagacgtct
gaaaccccggatgaactgcacctgacacatcctgacagggtgatcgacgccaccctgggt
gcgaccaagcgcgaagtcgccgaatactatgccgacatcagccaatggatcctgccacag
ctcaagcaccgcccggtggcgctggttcgcgcaccggacggcctggccggcgagctgttc
ttccaaaagaacgcgggccagctgcacatacccaacgtgcttagctacgaaaaggccgag
gccggccaggcggcgatggttatcaatcgcccagacacgctgctaggcgcggtgcagatg
aacatgcttgaactgcacacctggaacgccacggacaaggacttcgacaaacccgaccgc
ttcgtgctcgacctggaccctgaccccgcgttgccctggaaggccatgctggaggcgact
cagctcacccttaccctgcttgacgagctaggcctgaaggtgttcctgaaaaccagtgga
ggcaaaggcattcatgttgtagtgccgttgacccggcgcgccggctgggacgaagtcaaa
ggcttcagccacgccatcgtcaactatctggccacgttgttcccggaccgtctcagcgcg
gtgtctgggccgaaaaaccgtgttgggcgcatcttcatcgattacctgcgcaacagcaaa
ggcgccaccaccgcgtgcgcttactccctgcgagcccgagaggggctgcctgtttcggtg
cccatatggcgcgaggagctggtgcagctcaaggccgccaacacgtggaacatcgccaac
gtgcgcgagcgtctcgcagcagtcgaagacccatgggccgacctgggcaaggtgcgtcag
tccatcactgcccgcatgcgcaagcaactggggctctcgtga

DBGET integrated database retrieval system