KEGG   Pseudomonas putida GB-1: PputGB1_3197Help
Entry
PputGB1_3197      CDS       T00650                                 

Definition
(GenBank) cellulose synthase catalytic subunit (UDP-forming)
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00500  Starch and sucrose metabolism
ppg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PputGB1_3197
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ppg01003]
    PputGB1_3197
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppg02000]
    PputGB1_3197
Enzymes [BR:ppg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     PputGB1_3197
Glycosyltransferases [BR:ppg01003]
 Polysaccharide
  Structural polysaccharide
   PputGB1_3197
Transporters [BR:ppg02000]
 Other Transporters
  Others
   PputGB1_3197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Cellulose_synt Glyco_transf_21 PilZ
Motif
Other DBs
NCBI-ProteinID: ABY99089
UniProt: B0KHK7
LinkDB All DBs
Position
complement(3579778..3582387)
Genome map
AA seq 869 aa AA seqDB search
MTLTPLSAYTWFTARGARLPVAWLFTLGVWLAFLFLRLESPAWQALLAERQRLYPQLSGK
RPSLGDPLRLLIQSLWLLVRRQPVARTTGPGRRAWGAARLRLRGVGQVGRHYRGLLIDAL
HRVPARYRASAFRHEASARLRGLSVLARRVFYSVLTVCAASLALLCVTEPFGYLAQLMFI
CLLLGIAMLVRHMPGRFPTLMLIVLSTIISCRYLWWRYTSTLNWNDTTDLVFGVILLAAE
TYSWFVLILGYIQTSWPLQRKPANLPANPQHWPTVDLLIPTYNEDLSVVRTTVLAALGLD
WPRECLRIYILDDGRRDAFRAFADEAGVGYIVRPDSKHAKAGNLNHALGVTDSELIAIFD
CDHVPVRSFLQMTVGWFLKDPKLALVQTPHHFFSPDPFERNLGSFRRRPNEGELFYGLIQ
DGNDMWNAAFFCGSCAVLRRTALESIGGFAVETVTEDAHTALRMHRQGWSSAYLSIPQAA
GLATESLSAHIGQRIRWARGMVQIFRTDNPLFGRGLSLFQRVCYANAMLHFLAGLPRLIF
LTAPLAFLLLHAYIIYAPALMILLYVLPHMIHASLTNSRMQGKYRQTFWGEVYETVLAWY
IARPTTVALFAPKKGKFNVTAKGGLMEQAQFDWRIAQPYLWLAALNVVGLGFAVWRLFTG
PTAEIGTVIVSSLWVIYNLLIIGAAVAVAAEVRQVRRAHRVQMRLPAGLVLASGHAYPCT
LVDYSDGGVGLQVQQDLELKPGEQVRLLLNRGQREFAFQACVTRTVGQHVGLVFHALDQQ
QRIDLVHCTFARADAWLGWSEQHEVERPLRSLIDVLKLGGVGYLRLFEHMPPWLRARLRP
LRTLALWLASYGPRTPRAIPSMNPVDRDA
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
gtgaccttgactcctctgtcggcctatacgtggttcaccgcccgtggtgcgcggctaccg
gttgcctggctgtttaccttgggcgtgtggctggcctttctgttcctgcgcctggagtca
cccgcctggcaggcattgctggccgaacgccaacgcctgtacccgcagctttcaggcaag
cgcccgagcctgggtgacccgctacggctgctgatccagagcctgtggttgctggtgcgc
cgtcaaccggtggcacgcacaacagggcctggccgccgagcatggggcgcagcgcgcttg
cgactgcggggtgttggccaggttgggcgccattaccgagggctgctgatcgatgcactg
catcgggtgcccgcgcgctaccgcgccagtgctttcaggcacgaagcctcggcacgcctg
cgcggccttagcgtgctcgccaggcgggtgttctacagcgtgttgacggtgtgcgccgca
agcctggccctgctgtgcgtgactgaaccgttcggctacctggcgcaactgatgttcatc
tgcctgttgctgggcattgccatgctggtgcgacacatgccggggcgcttcccgaccctg
atgctgatcgtgctgtcgaccattatctcgtgccgctacctgtggtggcgctacacctcg
accctgaactggaacgacaccaccgacctggtgttcggggtgattctgttggcggccgaa
acctattcgtggttcgtattgatcctgggttacatccagaccagctggccgttgcagcgc
aaaccggccaacctgccggccaacccgcagcactggccgactgtcgatttgttgattcct
acctacaacgaagacctgtcggtggtgcgcaccacggtactggccgcgctgggcctggac
tggccgcgcgagtgcctgcgcatctacatcctcgatgacggccgccgtgatgcgtttcgt
gcttttgccgacgaagccggggtgggctacatcgtgcggcccgacagcaagcacgccaag
gccggcaacctcaaccatgcgctgggtgtgaccgacagcgagctgatcgccatcttcgac
tgcgaccacgtgccggtgcgctccttcctgcaaatgaccgtgggctggttcctcaaagac
ccgaagttggcgctggtgcagacaccgcaccatttcttctcgcccgacccgttcgagcgc
aacctcggctcgttccgccgtcgccccaatgaaggcgaactgttctacggcttgattcag
gatggcaacgacatgtggaacgcggcgtttttctgcggctcgtgtgccgtgctgcgccgc
accgcattggaaagcatcggcggttttgccgtcgagaccgtgaccgaagacgcccacacc
gccctgcgcatgcaccgccaggggtggtcgtcggcttacctgagcattccgcaggccgcg
ggcctggccaccgaaagcctgtcggcgcacattggccaacgcattcgctgggcccgtggc
atggtgcagatcttccgcaccgacaacccgttgttcgggcgtgggctcagcctgttccag
cgggtgtgctatgccaacgccatgctgcacttcctggccggcttgccacggctgatattc
ctgaccgcgccgctggcgttcctgttgctgcatgcctacatcatctacgcaccggcgttg
atgattctgctgtacgtgctgccgcacatgatccacgccagcctgaccaactcgcgcatg
cagggcaagtaccggcaaaccttctggggcgaggtgtacgagaccgtgctggcctggtac
atcgcccgcccgaccacggtggcgctgttcgcgccgaaaaagggcaagttcaacgtcacc
gccaaaggcggcctgatggagcaggcgcagttcgactggcgtatcgcccagccttacctg
tggttggcggcgctcaacgtggttggcctgggctttgccgtgtggcgcctgttcaccggc
cccacggcagaaatcggcacggtgatcgtcagctcgctgtgggtgatctacaacctgctg
atcattggcgccgccgttgccgtggccgccgaagtgcgccaggtgcgccgtgcccaccgc
gtgcagatgcgcttgccggcggggctggtactggccagcggtcatgcctacccctgcacc
ctggtcgattactccgatggcggtgtcggcctgcaggtgcagcaagacctagagctgaaa
ccgggggaacaggtacgtctgctgctcaatcgcggccagcgtgagttcgccttccaggcg
tgtgtcacccgtaccgtcgggcaacacgtgggcctggtgttccatgcacttgaccagcaa
cagcgcatcgatctggtccactgcacctttgcccgtgccgatgcctggcttggctggagc
gagcagcatgaggtggagcgcccgctgcgcagcctgatcgatgtactgaagctgggcggt
gtcggttacctgcgcctgttcgagcacatgccaccctggctgagggcgcgcttgcgccca
ctgcgtacgctggcgctgtggttggccagctatgggccccgcacaccgcgggcaatccct
tccatgaaccctgttgatcgagacgcatga

DBGET integrated database retrieval system