KEGG   Pseudomonas putida GB-1: PputGB1_3309Help
Entry
PputGB1_3309      CDS       T00650                                 

Definition
(GenBank) monooxygenase component MmoB/DmpM
  KO
K16244  phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00361  Chlorocyclohexane and chlorobenzene degradation
ppg00362  Benzoate degradation
ppg00623  Toluene degradation
ppg01100  Metabolic pathways
ppg01120  Microbial metabolism in diverse environments
ppg01220  Degradation of aromatic compounds
Module
ppg_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PputGB1_3309
   00361 Chlorocyclohexane and chlorobenzene degradation
    PputGB1_3309
   00623 Toluene degradation
    PputGB1_3309
Enzymes [BR:ppg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     PputGB1_3309
    1.14.13.244  phenol 2-monooxygenase (NADH)
     PputGB1_3309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MmoB_DmpM
Motif
Other DBs
NCBI-ProteinID: ABY99201
UniProt: B0KIP6
LinkDB All DBs
Position
complement(3713796..3714065)
Genome map
AA seq 89 aa AA seqDB search
MTSLVYIAFQDNDSARYIVEAITQDNPHAQVQHQPAMIRVQAEGRLEIHRATVEDKLGRE
WDVQEMLIDVITLGGNVEEDEDCFALHWN
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgacttccctcgtttatatcgccttccaggacaacgacagcgcccgctacatcgtcgag
gccatcacccaggacaacccccatgcccaggtgcagcaccagccggcgatgatccgcgtg
caggccgaagggcgcctggaaattcaccgcgccacggtggaagacaagcttggccgtgaa
tgggacgtgcaggaaatgctgatcgacgtgatcaccctcggcggcaacgtcgaggaagac
gaagactgcttcgccctgcactggaattga

DBGET integrated database retrieval system