KEGG   Pseudomonas putida GB-1: PputGB1_3533Help
Entry
PputGB1_3533      CDS       T00650                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppg  Pseudomonas putida GB-1
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PputGB1_3533
Enzymes [BR:ppg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PputGB1_3533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_oxidored DAO FAD_binding_3 NAD_binding_7 Glutaredoxin FMO-like Thi4 K_oxygenase NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABY99424
UniProt: B0KLP6
LinkDB All DBs
Position
complement(3936559..3938121)
Genome map
AA seq 520 aa AA seqDB search
MLDATLKSQLKTYLERVTQPIEIVASLDDGAKSRELHDLLVEIAGLSNLITFSADGTDAR
RPSFSLNRPGDSISLRFAGIPMGHEFTSLVLALLQVGGHPSKASAEVIEQIQALEGEFTF
ETYFSLSCQNCPDVVQALNLMAVLNPNVRHVAIDGALFQEEVEARKIMAVPSIYLNGEVF
GQGRMGLEEILGKIDTSAGARQAEKINAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTLAIENFISVQETEGPKLATALEEHVKQYDVDIMNLQRGEALIPASEGGL
HEVRLAGGASLKAKTVILATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAQVTLIEFDSQLRADAVLQRKLHSLPNVKVITSALTTEVLGNGE
KVTGLRYKDRTTDEQHDVALEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDAKGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLAAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccacgcttaaatcgcaactgaaaacctacctggagcgggtcacccagccg
atcgagatcgttgcctccctcgacgacggcgcgaagtcccgcgaattgcatgacttgctg
gtggaaattgccggcctgtcgaacctcattacattcagcgcggacggtaccgatgcccgt
cgcccgtcgttctcgctgaaccgcccgggtgacagcatcagcctgcgcttcgccggcatc
cccatgggccacgagttcacctcgctggtgctggcgctgctgcaagtcggcggccaccca
tccaaggccagtgctgaagtgatcgagcagatccaggccctggaaggcgaattcaccttc
gaaacctacttctcgctgtcgtgccagaactgcccggacgtggtccaggcgttgaacctg
atggcggtgctcaaccccaacgtgcgccatgtggccatcgacggtgcgctgttccaggaa
gaagtggaagcgcgcaagatcatggcggtgccgagcatctacctgaacggtgaagtgttt
ggccagggccgcatgggcctggaagaaatccttggcaagatcgacaccagcgccggcgcc
cgccaggccgagaagatcaacgctaaggacgccttcgacgtgctggtggtcggcggtggc
cccgctggcgccgctgctgccatctatgctgcgcgtaaaggcatccgcactggcgttgca
gccgagcgcttcggcggccaggtgctcgacaccctggccatcgagaacttcatctcggtg
caggaaaccgaagggcctaagctggccacggcgctggaagagcacgtcaagcagtacgac
gtcgacatcatgaacctgcagcgcggcgaagcgttgattccggccagcgagggtggcttg
cacgaagtacgcctggcaggcggtgcctcgctgaaagccaagaccgtgatcctggccacc
ggcgcccgctggcgtgaaatgaacgtgccaggtgagcaggaataccgtggccgtggcgtg
gcctactgcccgcactgtgatggccccctgttcaagggcaagcgcgtagcggtgatcggc
ggcggcaactcgggcgtggaggcggccatcgacctggccggtatcgtcgcccaggtgacg
ctgatcgagttcgacagccaactgcgtgccgacgcggttttgcagcgcaagttgcacagt
ttgccgaacgtgaaagtcattaccagcgcgctcaccaccgaggtgctgggcaatggcgag
aaagtgactggcttgcgctacaaggaccgcaccaccgatgaacagcatgacgtggcgctg
gaaggtatcttcgtgcagatcggactgttgcccaacaccgactggctcaaaggcaccgtc
gagctgtcgccgcgtggcgagatcatcgtcgacgccaagggccagaccagtatcccgggt
gtgtttgcagcgggtgacgtgacgaccgtgccgtacaagcagatcgtgattgcggtgggt
gagggggccaaggcttcgctggcggccttcgaccacctgattcgcacttcggcgccggcg
taa

DBGET integrated database retrieval system