KEGG   Pseudomonas putida GB-1: PputGB1_3658Help
Entry
PputGB1_3658      CDS       T00650                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00500  Starch and sucrose metabolism
ppg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PputGB1_3658
Enzymes [BR:ppg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PputGB1_3658
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     PputGB1_3658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap Glyco_hydro_77 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ABY99549
UniProt: B0KMU5
LinkDB All DBs
Position
complement(4067686..4071006)
Genome map
AA seq 1106 aa AA seqDB search
MAKRARTAAFIDDPLWYKDAVIYQLHIKSFFDSNNDGIGDFAGLISKLDYIAELGVNTLW
LLPFYPSPRRDDGYDIADYKAVHPDYGSLGDARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARHAKRGSKARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYAHQ
PDLNFDNPQVLKAVIGVMRFWLDLGVDGLRLDAIPYLIERDGTNNENLAETHDVLKAIRA
EIDANYPDRMLLAEANQWPEDTRPYFGEGEGDECHMAFHFPLMPRMYMALAMEDRFPITD
ILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAEDRRARINLGIRRRLAPL
LQRDRRRIELLTSLLLSMPGTPTLYYGDELGMGDNIYLGDRDGVRTPMQWSPDRNGGFSR
ADPQRLVLPPIMDPLYGYQTVNVEAQSHDPHSLLNWTRRMLAVRKQQKAFGRGSLRTLTP
SNRRILAYVREYTDVDGNTEVILCVANVSRAAQAAELELSHFADKVPVEMLGGSAFPPIG
QLPFLLTLPPYAFYWFLLASRDRMPSWHIQPTEGLPELTTLVLRKRMEELLEAPSSDTLQ
ATILPQYLPKRRWFAGKEGPIDAVRLCYGVRFGTATTPVLLSEIEVRSDGTATRYQLPFG
LLREEQITTALPQQLALSRVRRAHQVGLITDAFVLEPFIRAVMLACQDGLRLPCGNDEGE
LRFECTAQLAGLALDEESEVRYLSAEQSNSSVVIGDRVVLKLIRRVNPGVHPELEMSAYL
TAAGFANISPLLAWVSRVDEQQAPHLLMIAQGYLNNQGDAWGWTQNTLERAIRDQMEPTT
SDPEAHTDALAELSGFAALLGQRLGEMHLLLAAPTEDPAFQPRPSNAQDSQRWSTQISAE
LTHALDLLAQHRDTLDRDSQALVDDLQQQRDGLAQHIDNLTDQAQGGLLMRVHGDLHLGQ
VLVVQGDAYLIDFEGEPARSLEERRAKHSPYKDVSGVLRSFDYAAAMILRSASAVDLSDP
ARQARQRVARQYLHQSRHAFVEAYGLATAAMPHAWQRAEGERAALELFCLEKAAYEITYE
AENRPSWLAVPLHGLHGLISTWGESE
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgtgcccgcacggcagccttcatcgacgacccgctgtggtacaaggacgcc
gtcatctaccagttgcatatcaagtcgttcttcgattcgaacaatgatggtatcggcgac
ttcgccggcctgatcagcaaactcgactacatcgccgagctgggcgtcaacaccctgtgg
ctgctgccgttctacccctcgcctcggcgcgatgacggctacgacattgccgattacaaa
gccgtgcaccccgactacggcagcctgggcgatgcccggcgtttcatcgccgaggcacat
aagcgcggcttgcgggtgatcaccgagctggtcatcaaccacaccagcgaccagcacccg
tggtttcagcgtgcccgccatgccaaacgcggcagcaaggcgcgcgatttctacgtgtgg
tcggacgacgaccagaaatacgacggcacgcgcatcatcttcctcgacaccgaaaagtcc
aactggacatgggacccggtcgctggccagtacttctggcaccgcttctacgcgcaccag
ccagacctcaacttcgacaacccgcaagtactcaaggcggtgatcggcgtgatgcgcttc
tggctcgacctgggtgtcgacggcctgcgcctggacgccatcccgtacctgatcgaacgc
gacggcaccaacaacgagaacctcgccgaaacccacgacgtgctcaaggcgatccgcgca
gaaatcgacgccaactaccccgaccgcatgctgctggccgaagccaaccagtggccggaa
gacacgcgtccatacttcggcgaaggcgagggcgacgaatgtcacatggccttccacttt
ccgttgatgccacgcatgtacatggccctggccatggaagaccgcttcccgatcaccgac
atcctgcgccagaccccggaaattcccgccaactgccaatgggcgattttcctgcgcaac
cacgatgagctgaccctggaaatggtcaccgaccgcgagcgcgactacctgtggaactac
tacgccgaagaccgccgcgcgcgcatcaacctgggtatccgccggcgcctggcgccgctg
ctgcagcgtgaccgtcggcgcatcgagctgctcaccagcctgctgctgtcgatgcccggc
acaccaaccctgtattacggcgacgaactgggcatgggcgacaacatctacctgggtgat
cgcgatggcgtgcgtacgcccatgcagtggtcgccggaccgcaacggcgggttctcccgc
gccgacccgcagcgcctggtgctgccgccgatcatggacccgctgtacggctaccagacc
gtcaatgtcgaagcgcaaagccacgacccgcattcactgctgaactggacccggcgcatg
ctggcggtgcgcaagcagcagaaggcctttggccgcggcagcctgcgcacgctcacgccc
agcaaccggcgcattctcgcctacgtccgcgagtacaccgatgtcgacggcaacaccgag
gtcattctgtgcgtggccaacgtgtcgcgcgctgcccaggccgcagaactggaattgtca
cacttcgccgacaaagtaccggtggagatgctcggcggcagcgccttcccgcccattggc
cagttgccgttcctgctgaccttgccaccctatgccttctactggttcctgctggccagc
cgtgaccgcatgcccagctggcatatccagcccaccgaggggttacctgaattgaccacg
ctggtactgcgcaagcgcatggaagaactactggaagcaccttcaagcgataccctgcaa
gccaccatcctgccgcaatacctgcccaagcggcgttggttcgccggcaaggaagggccg
atcgacgccgtgcgcctgtgttacggcgtgcgttttggcactgccaccacaccggtgctg
ctcagtgaaatcgaagtgcgcagcgacggcacggccacccgctaccaactgccgttcggc
ctgctgcgcgaggagcagatcactaccgcgctgccgcagcagttggccttgtcgcgggtg
cgccgcgcccaccaggttggcttgatcacagatgccttcgtgctggagccgttcatccgc
gccgtgatgcttgcctgccaagatggcctgcgcctgccatgcggcaacgatgagggtgaa
ttgcgcttcgaatgcacggcgcaattggccggcctggctctcgacgaggaaagtgaagtg
cgctacctcagcgccgaacagtccaacagttcggtagtgatcggcgaccgggtggtgctc
aagctgatccgccgggtcaacccaggtgttcatccagagctggaaatgagtgcctacctg
accgccgccggctttgccaacatctcgccgctgctggcctgggtcagccgagtggatgag
cagcaggcaccgcacctgctgatgattgcccagggttacctgaacaaccagggcgatgcc
tggggctggacccagaacacccttgaacgggccattcgcgaccagatggagcccaccacc
agcgaccccgaggcgcacaccgacgcactggccgagctcagtggcttcgctgccttgctt
ggccagcgcctgggcgagatgcacctgttgctggccgcgccaaccgaagacccggccttc
cagccacgtcccagcaatgcgcaggacagccagcgttggagtacgcagatcagcgccgag
ctgacccacgctctcgacctgctggcccaacaccgcgacacgctcgaccgcgatagccag
gccctggtcgatgacctgcagcagcagcgcgacggcctggcccagcacatcgacaatctg
accgaccaggcccagggcggcctgttgatgcgggtgcatggcgacctgcacctgggccag
gtgctggtggtgcaaggtgatgcctacctgatcgatttcgaaggcgagccggcccggtcg
ctggaagagcgtcgggcaaaacacagcccgtacaaggatgtcagcggcgtgctgcgatcc
ttcgactatgctgctgcgatgatcttgcgcagcgcgtctgcggtggacctttcagacccg
gcgcggcaggcccggcaacgggttgcccggcagtacctgcaccagtcgcggcatgccttt
gtcgaagcctatggcctggccaccgccgccatgccccacgcctggcagcgggccgagggc
gagcgcgcggctctggagctgttctgcctggaaaaagccgcctacgagattacctacgaa
gccgagaaccgtccgagttggctggccgtgcctttgcatggcctgcatggattgatcagt
acctggggagagtcagaatga

DBGET integrated database retrieval system