KEGG   Pseudomonas putida GB-1: PputGB1_4510Help
Entry
PputGB1_4510      CDS       T00650                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00473  D-Alanine metabolism
ppg00550  Peptidoglycan biosynthesis
ppg01100  Metabolic pathways
ppg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PputGB1_4510
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PputGB1_4510
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    PputGB1_4510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppg01011]
    PputGB1_4510
Enzymes [BR:ppg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PputGB1_4510
Peptidoglycan biosynthesis and degradation proteins [BR:ppg01011]
 Precursor biosynthesis
  Amino acid ligase
   PputGB1_4510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATPgrasp_YheCD ATPgrasp_Ter TTL GARS_A ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: ABZ00397
UniProt: B0KFS4
LinkDB All DBs
Position
complement(5046037..5046993)
Genome map
AA seq 318 aa AA seqDB search
MTSAYDKLHSTLDVKAFGRVAVLYGGKSAEREVSLKSGAAVIDALTTAGVDVVAIDVGDD
LLARLQSEEIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ
SLGIPTPRHAVLASESDCLQASTELGFPLIVKPAHEGSSIGMAKVNSAQELVAAWQDAAK
YDSQVLVEQWIHGPEFTIAVLRGQVLPPIALGTPHVFYDYDAKYIANDTQYRIPCGLDSA
KEQELIDLTARACDAIGIEGWGRLDVMQDEQGRFWLLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAESVATRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcctacgacaagctgcactccaccttggacgtcaaggcattcggccgcgtt
gccgtgctgtacggtggcaagagcgccgagcgtgaggtgtcgttgaagtctggcgctgcg
gtgatcgatgcgctgacaactgccggtgtcgacgtggttgccatcgacgtcggtgacgac
ctgctcgcgcgcctgcaaagcgaggaaatcgaccgcgccttcatcatcctccacggccgt
ggcggtgaagacggcagcatgcaaggcctgctggagtgccttggcatcccctacaccggc
agcggcatccttgcttcggcgctggccatggacaagctgcgcaccaagcaggtgtggcag
agcctgggcattccgaccccgcgtcacgcggtattggcgagcgaaagcgattgtttgcag
gccagtacggaactgggcttcccgcttatcgtcaaacccgcccatgaaggctctagcatc
ggcatggccaaggtgaacagcgcccaggaactggtcgccgcctggcaggacgccgccaaa
tacgattcccaggtactggtggaacagtggatccacggcccggagttcaccatcgcggta
ctgcgcggccaggtgctgccgccgatcgccctgggtacgccgcacgtgttctacgactac
gacgccaagtacatcgccaacgatacccagtaccgcatcccgtgcggcctggatagcgcc
aaggaacaggaactgatcgacctgaccgcacgtgcctgcgatgccatcggcatcgaaggc
tgggggcggctggacgtgatgcaggacgagcagggccggttctggctgctcgaagtcaac
accgcaccaggcatgacagatcatagcctggtgcccatggcggcccgcgcggccggcttg
gacttccagcaactggtgctggcaatcctggccgaaagcgtggcgacgcgaggttaa

DBGET integrated database retrieval system