KEGG   Pseudomonas putida GB-1: PputGB1_4621Help
Entry
PputGB1_4621      CDS       T00650                                 

Definition
(GenBank) Trans-2-enoyl-CoA reductase (NAD(+))
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
ppg  Pseudomonas putida GB-1
Pathway
ppg00061  Fatty acid biosynthesis
ppg00650  Butanoate metabolism
ppg01100  Metabolic pathways
ppg01120  Microbial metabolism in diverse environments
ppg01200  Carbon metabolism
ppg01212  Fatty acid metabolism
Module
ppg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ppg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PputGB1_4621
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PputGB1_4621
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppg01004]
    PputGB1_4621
Enzymes [BR:ppg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PputGB1_4621
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     PputGB1_4621
Lipid biosynthesis proteins [BR:ppg01004]
 Fatty acid synthase
  Component type
   PputGB1_4621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: ABZ00508
UniProt: B0KGW2
LinkDB All DBs
Position
complement(5158018..5159229)
Genome map
AA seq 403 aa AA seqDB search
MAIIHPKVRGFICTTTHPKGCELNVRDQIEATRKLGVREDGPKKVLVIGASSGYGLAARI
TAAFGFKADTLGVFFEKPGTETKAGTAGWYNSAAFDKFAKAEGLYSKSINGDAFSDEARA
KVIELIKNEMGGKVDLVIYSLASPVRKLPQTGEVIRSALKPIGEPYKSTAIDTNKDTIIE
ASIEPATEQEIADTVTVMGGQDWQLWIDALAGANVLAEGARTVAFSYIGSDITWPIYWHG
ALGQAKQDLDETALRLDQKLADEVKGGANVAVLKSVVTQASSAIPVMPLYLSMVFKIMQE
KGIHEGTQNQLDRMYRDRMYRADGAPADVDEKGRLRLDDWELRDDVQTACKALWPQVTTE
NLFELTDYAGYKKQFLNLFGFERADVNYDEDVATDVKFDCIEL
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttggccatcattcatcctaaggttcgcggtttcatctgcaccacgactcacccgaagggc
tgcgagctcaacgtccgtgaccagatcgaagccacccgcaagctgggcgtgcgcgaggat
ggcccgaagaaggtcctggtcattggcgcttccagcggctacggcctggcagctcgcatc
accgcggcgttcggcttcaaggccgacaccctgggtgtgttcttcgaaaagcctggcact
gagaccaaggccggcaccgctggctggtacaactctgcagccttcgacaagtttgccaag
gccgaaggcctgtacagcaagtcgatcaacggtgacgccttctctgacgaagcccgtgcc
aaggtcatcgaactgatcaagaacgaaatgggtggcaaggtcgacctggtcatctactcg
ctggcatcgcctgtgcgcaagctgccgcagaccggtgaagtgattcgctcggcactcaag
ccgatcggcgagccgtacaagtcgaccgccatcgacaccaacaaggacaccatcatcgag
gccagcatcgagccggccacggagcaggaaatcgccgacaccgtcaccgtcatgggtggc
caggactggcagctgtggatcgatgccctggcaggcgccaacgtgctggccgaaggcgct
cgcaccgtggccttcagctacatcggcagcgatatcacctggccgatctactggcacggt
gccctgggccaggccaagcaggacctggacgaaaccgccctgcgtctggaccagaaactg
gccgatgaagtgaaaggcggcgccaacgtggccgtgctcaagtcggtggtgacccaggcc
agctcggccatcccggtgatgccgctgtacctgtcgatggtcttcaagatcatgcaggag
aaaggcattcacgaaggtactcagaaccagctcgaccgcatgtaccgcgaccgtatgtac
cgtgccgacggtgcgccggccgacgttgacgagaagggccgtctgcgcctggacgactgg
gaactgcgcgacgacgttcagaccgcctgcaaggccctgtggccacaagtgaccaccgag
aacctgttcgagctgaccgactacgccggttacaagaagcagttcctcaacctgttcggt
ttcgagcgcgctgacgtcaactacgacgaagacgtggccaccgatgtcaagttcgactgc
atcgagctgtaa

DBGET integrated database retrieval system