KEGG   Pelodictyon phaeoclathratiforme: Ppha_1539Help
Entry
Ppha_1539         CDS       T00731                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pph  Pelodictyon phaeoclathratiforme
Brite
Enzymes [BR:pph01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Ppha_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACF43788
UniProt: B4SA92
LinkDB All DBs
Position
1621498..1622100
Genome map
AA seq 200 aa AA seqDB search
MAYQQPALLYAENALEPFISAKTLGFHYGKHHVAYITNYNNLVAGTPLDTMSLEEVIAHS
AADPQKVGIFNNGAQAWNHSFYWNCLTPNGGGEPSGELGAKITEDFGSFDKFKEELKSAA
ATQFGSGWAWLVLDGTTLKVVKTANAQTPSTSGQKPILTIDVWEHAYYLDYQNRRPDYVA
TVIDNLLNWEFAAENFRAAQ
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcagcaaccagcacttttatacgcagagaacgcactggaaccatttatttcc
gcaaaaacccttgggtttcactatggcaagcatcatgttgcatacatcaccaattacaac
aaccttgtcgccggtacacctctcgacaccatgagccttgaagaggtcatagcccatagc
gctgccgacccgcagaaagtcggcatattcaataacggcgcacaagcctggaaccactcc
ttctactggaactgcctgacacccaacggtggcggggaaccctccggagaacttggagca
aaaattacagaagatttcggcagcttcgacaaattcaaagaagagcttaaaagcgcagcc
gcaactcaatttggcagtggatgggcatggctcgtccttgatggaacaacgctgaaggta
gtaaaaaccgccaatgcacaaacaccttcaaccagcggtcaaaaaccgatcctcaccatt
gacgtctgggagcacgcatactacctcgattatcagaaccgccgccccgactatgtcgca
accgtgatcgacaacctgctcaactgggaatttgctgctgaaaatttccgcgctgcacag
taa

DBGET integrated database retrieval system