KEGG   Pseudoalteromonas phenolica: PP2015_1131Help
Entry
PP2015_1131       CDS       T04165                                 

Definition
(GenBank) D-alanylalanine synthetase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pphe  Pseudoalteromonas phenolica
Pathway
pphe00473  D-Alanine metabolism
pphe00550  Peptidoglycan biosynthesis
pphe01100  Metabolic pathways
pphe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pphe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PP2015_1131
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PP2015_1131
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PP2015_1131
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pphe01011]
    PP2015_1131
Enzymes [BR:pphe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PP2015_1131
Peptidoglycan biosynthesis and degradation proteins [BR:pphe01011]
 Precursor biosynthesis
  Amino acid ligase
   PP2015_1131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 ATPgrasp_Ter GARS_A ATPgrasp_ST ATPgrasp_YheCD GSH-S_ATP
Motif
Other DBs
NCBI-ProteinID: ALO41647
UniProt: A0A0S2K0P9
LinkDB All DBs
Position
I:1317634..1318758
Genome map
AA seq 374 aa AA seqDB search
MSVNTALNTLKLNGRIAVIYSADPAQVGSVIYRSYNTRSWKSYQKVANDIKVGLKQAGFN
HVICLADDQHLARQLAENKIDFAWLNTGGMQGADPCCHGAALLESLGIPYVGHTPLNAAL
MDNKFLFKKLLQQLAIPTAEYVLWHPEKLNTAEELVLRHNKLHFFGDAKLIVKPVSGRAS
NHVYLVSSLSELNEVCQQVFSHTQSAVLIEQFLPGDEYCASVIPTMGELASPTCFGIYQR
NLGPGNSIFTSMDIKPIGTDSIIILSDEQQVHLNETVTAYCRKLFSVLNLYGLFRLDLRM
DEQGQLCVLEANPKPDLGAVHNGTGSLVAMGLQELKVSYTQFLDYLVQVSLSHLSLHRTP
KYHALLARIGAPCQ
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttaatacggcactgaatacactgaaattaaatggacgtattgcggtgatttat
tctgctgatcctgcacaagtaggttcagtgatttatcgaagctacaacacgcgaagctgg
aaaagctatcaaaaggtggcgaatgatatcaaggtgggtctaaagcaagcgggatttaat
catgttatttgtttagcagatgatcagcatttagctaggcagttagctgaaaataaaatc
gactttgcttggctaaatacgggggggatgcaaggcgcagatccctgttgccatggtgct
gcacttttagaaagtttggggatcccttatgttgggcatacgccgcttaatgcagcgctt
atggataataagtttttatttaaaaagctgttacagcaacttgctattcctactgcagag
tatgtgctctggcaccctgaaaagctaaatacagctgaagaattggtgctcaggcataac
aaacttcacttctttggcgatgccaaactcatagttaaacccgtatcggggcgagcttct
aaccatgtgtatttagtgagctctttgagcgaattaaatgaggtttgtcagcaggtgttt
tctcacacacaaagtgccgttttaattgagcagtttttaccaggagacgagtattgtgct
tcagtgatcccaaccatgggtgaactggcttcgcccacctgttttggtatatatcagcgt
aatttaggacctggcaattccatatttacgtcaatggatattaaaccaatcggtactgat
tccattattatattatctgatgaacagcaagtgcatcttaatgagacagtgacagcttat
tgtagaaagctcttttcagtgttgaatttatatggcttgtttaggctcgatttgagaatg
gatgaacaagggcagttatgcgttcttgaagcaaaccccaaacctgacctaggggctgta
cacaatggtacaggcagtttagttgcaatgggtttgcaagagctcaaagtttcttatacc
cagtttttagactatttagtccaagtcagtttgagccacttatctttgcatcgaacacct
aaatatcatgcgctgttagcacgaataggtgcgccatgtcagtaa

DBGET integrated database retrieval system