KEGG   Pseudoalteromonas phenolica: PP2015_121Help
Entry
PP2015_121        CDS       T04165                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pphe  Pseudoalteromonas phenolica
Brite
KEGG Orthology (KO) [BR:pphe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PP2015_121
Enzymes [BR:pphe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PP2015_121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored NAD_binding_7 AlaDh_PNT_C Thi4 Glutaredoxin NAD_binding_8 FAD_binding_3 K_oxygenase FMO-like Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ALO40649
UniProt: A0A0S2JXB0
LinkDB All DBs
Position
I:complement(137639..139216)
Genome map
AA seq 525 aa AA seqDB search
MLDQNIKTQLQSHFAAITDPIELVLALDDSNKSNELKSLANDLSSLSTHITVSEQSDSTR
APNMSVRSPKRNTHIDFAGIPMGHEFTSLVLALLQTGGHPSKASEEELSIIDGITEPLNF
EIYISLSCQTCPQVVQALNTMAARNSNIKATMIDGALFQDEVNARNIMAVPSVFLNGEQF
SQGAVSLSDILNKLDTGAAAKQAEKLNEKDPFDVLVVGGGPAGASAAIYAARKGLNTGVV
AERFGGQVADTLAIENFISVKATEGPKLVAQLEEHVKEYDVDIMKGQRAAGIARGDYIEV
PLESGATLKAKSVIMATGARWRNMNVPGEQEYKGKGVAYCPHCDGPLFKGKPVAVIGGGN
SGIEAAIDLANITSHVTVLEFADTLRADEVLIRKANSLPNITIIKNAQTTEVLGDGQRVT
GLSYTDRVSGEQHQVDLAGIFVQIGLIPNSEFLKETDVQLSRFGEIEVDKHGATSMSGVY
AAGDVTDSAFKQIIIAMGSGATASLGAFDYLIRHSDESQTEASAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctagaccaaaacattaaaacgcaattacaaagccactttgctgccattaccgatcct
atcgagctagtgcttgccctagatgacagcaacaaatcaaacgaattaaaaagcttagca
aacgatttaagttcattaagcacacacatcacagtgtcagaacaaagtgattcgacccgt
gctccgaacatgtctgtgcgctctcccaagcgtaatacacacatcgattttgcgggcatt
cctatgggtcatgagtttacctcattggtattggcactgttacaaacaggtggacaccca
agcaaagcctctgaagaagagctgagcatcattgatggcattactgagccattaaacttt
gaaatttatatatctctgagctgccaaacttgtccgcaagtggttcaggcgcttaatact
atggcggccagaaacagcaatattaaagcgaccatgatcgacggcgcactgttccaagac
gaagtgaacgcacgcaatatcatggctgtaccaagtgtatttttaaacggtgagcaattc
tcacaaggcgcggtatcgctgagcgatattctcaataagctagacacaggcgcggcggcc
aaacaagccgagaagctcaatgaaaaagacccatttgacgtactggttgtcggtggtggc
cctgcgggtgcatcggcagctatttatgcggcacgaaaaggtttaaacaccggtgttgtt
gccgagcgttttggtggccaagttgctgataccctcgccattgagaactttatttcagtc
aaagccactgaagggccaaagctggttgcacaacttgaagagcacgttaaagaatacgat
gtcgatattatgaaaggccaacgcgctgcgggtattgctcgtggtgactacatcgaagtg
ccccttgagtcaggcgcgacgttaaaagccaagtcagtgatcatggcaaccggtgcacgc
tggagaaacatgaatgtaccaggcgagcaagaatacaaaggcaaaggtgttgcttactgc
ccacactgtgacggcccattatttaaaggcaagccagttgcggtgatcggcggcggtaac
tcaggtattgaagcggcgattgaccttgcaaacattacttcgcacgtcactgtattagaa
tttgccgacacattacgtgctgacgaggtgcttattcgcaaagccaacagcttgccaaat
atcaccatcatcaagaatgcacaaaccaccgaagtgctaggcgatggtcaacgtgtaaca
ggattaagctacaccgaccgcgtatcaggtgagcaacaccaagtcgatttagccggtatt
tttgtacagattggcttaatcccgaacagtgaattcttaaaagagaccgacgtacaacta
agccgctttggtgaaattgaagttgataaacacggcgccaccagcatgagcggtgtgtat
gctgcgggtgatgtgactgactcagcgtttaagcaaatcattatcgccatgggctcaggg
gcaaccgccagcttaggggcttttgattaccttattcgccacagcgatgaatcacaaacc
gaagcaagcgcagcgtaa

DBGET integrated database retrieval system