KEGG   Pseudoalteromonas phenolica: PP2015_1416Help
Entry
PP2015_1416       CDS       T04165                                 

Definition
(GenBank) Zinc metallopeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pphe  Pseudoalteromonas phenolica
Brite
Enzymes [BR:pphe01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     PP2015_1416
Peptidases [BR:pphe01002]
 Metallo Peptidases
  Family M2
   PP2015_1416
Exosome [BR:pphe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PP2015_1416
CD molecules [BR:pphe04090]
 Proteins
  PP2015_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ALO41921
UniProt: A0A0S2K112
LinkDB All DBs
Position
I:complement(1626664..1628478)
Genome map
AA seq 604 aa AA seqDB search
MTAKFKLSIGALIVSSTLALTACNTVSQNKKVTEQDAETFLASSAETLVDLNARASRAAW
IYANFITEDTASLSADVNREYTDVVVRLANEAAKFDSLSLSEDNRRKMDKLKLALTLPAP
QNAEKSKELAGILAELDGMYGKGKYCKGNECMSLGDMTSKMASSRDYEELLDIWQGWRQV
AKPMRPLYEKQVVLTNEGAKELGYADTGAMWRSKYDMPADDFADELDRIWGQVKPLYDSL
HCHVRAKLGEKYGEDKVPQDQPIPAHLLGNMWAQTWGNIYDVVAPENADPGYDVTQLLAK
HNYDELTMVKGAEKFFTSMGFAPLPETFYSRSLFTKPQDRDVQCHASAWNLDSKDDLRIK
MCIQRTGEEFSVIHHELGHNFYQRAYNTQPVYYQESANDGFHEAIGDTIALSVTPGYLKE
IGLLDEVPDESKDIGLLMKMALDKVAFIPFGLLVDQWRWKVFNGEISPAEYNQAWWELRE
KYQGIQAPITRTENDFDPGAKYHVPGNVPYTRYFLAHILQFEFHKALCEIAGNKGSIHRC
SVYNSKEAGERLNTMLEMGSSRPWQEALATLTGKEQMDATAILDYFKPLQKYLDEQNKGR
QCGW
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaaatttaaactaagtattggtgcgttaatcgtatcaagtacactcgcactt
acagcctgtaataccgtaagccaaaacaaaaaagtcactgaacaagatgccgaaactttt
ttagcaagctccgcagaaacgttggtagaccttaacgctagagcatctcgtgcggcttgg
atttatgcaaactttattacagaagacactgcgtcactctctgctgatgttaatcgtgaa
tatacagacgttgttgtacgtttagctaatgaagcagcaaaatttgattcactttctctg
agcgaagataatcgccgaaaaatggacaaactcaaattagcgcttactttacctgctccc
caaaatgcagaaaaatctaaagaacttgcaggcattctagctgaattagacggcatgtat
ggtaaaggcaaatactgtaaaggcaatgagtgcatgagcttgggtgatatgacatccaaa
atggcctcgtctagagattacgaagagttactagatatctggcaaggttggcgacaagtt
gcaaagccaatgcgccctctttatgaaaagcaagttgttttaacaaacgaaggcgcgaaa
gaattaggctatgccgatactggggctatgtggcgaagtaaatatgatatgcctgctgat
gactttgcagatgaacttgacagaatttggggtcaagtaaaaccactttatgattcatta
cattgtcacgttcgcgccaagcttggtgagaagtatggcgaagataaagtaccacaggac
caaccgatcccagctcacttactaggcaatatgtgggcacaaacttggggcaatatttac
gacgttgttgcacctgaaaatgcagatccaggctatgatgtgacccaactgctagcgaaa
cataactatgatgagctaactatggtcaaaggtgctgaaaagtttttcacttcgatggga
tttgctccactgcctgaaacattttatagtcgctcactgttcaccaaacctcaggataga
gatgtacaatgccatgcttctgcgtggaatctagattcaaaagacgatttgcgtatcaag
atgtgtattcagcgtaccggcgaagaattttctgtaattcaccacgaattagggcataac
ttctatcaacgcgcttataatacccaacctgtttattatcaagaaagtgcaaatgatggt
ttccatgaagccattggcgatacaattgctctatctgttacacctggttacttaaaagaa
atcggtttattagatgaagtacctgatgaatcaaaagacattggtttgttaatgaagatg
gcgctagacaaagtagcgtttattcctttcggcttactcgtggatcaatggcgttggaaa
gtgttcaatggtgaaattagcccggcagaatacaaccaagcttggtgggagcttcgtgaa
aaatatcaaggaattcaagcgccaataacaagaacagagaacgattttgatccaggtgca
aaatatcatgtaccaggtaatgtaccttacacacgttatttcttagcacatattttacaa
tttgagttccataaagcgctgtgtgaaatagccggtaacaaaggctcgattcatcgttgc
tctgtttataactctaaagaagctggtgaacgtttaaacacaatgcttgagatgggcagc
agtcgtccatggcaagaagcattagctacgcttactggcaaagaacaaatggatgcaaca
gccattcttgattacttcaaaccattgcaaaaatatttagatgaacaaaacaaaggccgt
caatgcggctggtaa

DBGET integrated database retrieval system