KEGG   Pseudoalteromonas phenolica: PP2015_142Help
Entry
PP2015_142        CDS       T04165                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pphe  Pseudoalteromonas phenolica
Brite
KEGG Orthology (KO) [BR:pphe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pphe03012]
    PP2015_142
   03029 Mitochondrial biogenesis [BR:pphe03029]
    PP2015_142
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pphe04147]
    PP2015_142
Translation factors [BR:pphe03012]
 Eukaryotic Type
  Elongation factors
   PP2015_142
 Prokaryotic Type
   PP2015_142
Mitochondrial biogenesis [BR:pphe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PP2015_142
Exosome [BR:pphe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PP2015_142
  Exosomal proteins of breast cancer cells
   PP2015_142
  Exosomal proteins of colorectal cancer cells
   PP2015_142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ALO40670
UniProt: A0A0S2JXI1
LinkDB All DBs
Position
I:165433..166617
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERSKPHVNVGTIGHVDHGKTTLTAAITNVLAKVYGGDAKDFASIDNAPEERERG
ITISTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLSRQVGVPYIVVFMNKCDMVDDEELLELVEMEVRELLSEYDFPGDDLPLIQGSALKALE
GEKEWEDKIVELAEALDSYIPEPERDIDKPFIMPIEDVFSIQGRGTVVTGRVEAGIINVN
DEVEIVGIKETTKTTCTGVEMFRKLLDEGRAGENIGALLRGTKRDEVERGQVLCKPGSIN
PHTKFTSEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGNVELPEGVEMVMPGDNIKMT
VELIVPIAMDEGLRFAIREGGRTVGAGVVATIVE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaaagtttgaacgttcgaaaccgcacgtaaacgtaggtacaatcggccac
gttgaccacggtaaaacaactctaactgcagcaatcactaacgtacttgcaaaagtatac
ggtggtgacgcaaaagacttcgcatcaatcgataacgctccagaagagcgtgagcgtggt
atcacaatctcaacttcacacgttgagtatgacacaccaactcgccactacgcacacgta
gactgtccaggacacgctgactatgttaaaaacatgatcactggtgctgcacagatggac
ggcgcgatcctagtagttgcagctactgacggtcctatgcctcagacacgtgagcacatc
ctactttcacgtcaggttggtgtaccttacatcgttgtattcatgaacaaatgtgacatg
gttgacgacgaagagctactagagctagtagagatggaagttcgtgaacttctttctgag
tacgacttcccaggtgacgacctacctctaatccagggttcagcgcttaaagcactagaa
ggcgagaaagagtgggaagacaagatcgttgagcttgcagaagcactagattcttacatc
ccagagccagagcgtgacatcgataagccgttcatcatgcctatcgaagacgtattctca
atccaaggtcgtggtactgttgtaactggccgtgttgaagctggtatcatcaacgtgaac
gacgaagttgaaatcgtaggtatcaaagaaactacgaagacaacttgtacgggtgttgaa
atgttccgtaagcttctagacgaaggtcgtgctggtgagaacatcggtgcacttctacgt
ggtactaagcgtgacgaagttgagcgtggtcaggttctatgtaagcctggttcaatcaac
ccacacacgaagttcacttcagaagtatacgtactatctaaagacgaaggtggccgtcat
actccattcttcaaaggctaccgtccacagttctacttccgtacaactgacgtaacaggt
aacgttgagttaccagaaggcgtagaaatggtaatgccaggtgacaacatcaagatgact
gttgagctaatcgttccaatcgcgatggacgaaggtctacgtttcgcgatccgtgaaggt
ggccgtacagtaggtgctggtgttgtagctacaatcgtagaataa

DBGET integrated database retrieval system