KEGG   Pseudoalteromonas phenolica: PP2015_2617Help
Entry
PP2015_2617       CDS       T04165                                 

Definition
(GenBank) Chromosome partition protein Smc
  KO
K03529  chromosome segregation protein
Organism
pphe  Pseudoalteromonas phenolica
Brite
KEGG Orthology (KO) [BR:pphe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pphe03036]
    PP2015_2617
Chromosome and associated proteins [BR:pphe03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    PP2015_2617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_15 AAA_21 AAA_29 AAA_23
Motif
Other DBs
NCBI-ProteinID: ALO43105
UniProt: A0A0S2K471
LinkDB All DBs
Position
I:complement(3002441..3005833)
Genome map
AA seq 1130 aa AA seqDB search
MRLTHIKLAGFKSFVEPSKIPFPDQMTCVVGPNGCGKSNVIDAVRWVLGESSAKNLRGDA
MTDVIFNGSTHRKPVSQASVELFFDNTSGVLQGSLANRNQIAIKRLVTRDGQSLYFLNGS
KCRKRDITDIFLGTGLGPRSYAIIEQGMISRLIESRPQELRVFLEEAAGVSKYKERRRET
QTRIQSTRDNLERLLDMRQELKNQLDKLSVQAEQAKQYRELKRDERLLKGQVAVIKWQKL
NAQQQQKAAEIAELEKQIRFFSDAHQGHADVLSALEAKLEQDTHKLEETQQQKHRIHTEI
IRFEQQKLSAQQQKTQLQADIDKQKQAFKEAQDALQTLQQAQTEFTEQQQAAEQGLEQVK
DVLLKAQSAFESSQAAHKAQQTKLTAGQHEISEQRQALQQAEQNCKQAELSLTHLQENIA
DVAKQIEQQQSQSVTKELDAAKAEFNQLAKQMAGLQSQGKQLAVALDEAQTNYTKAELEE
RESAQKISSYKANISALENVLNSLTDDVKQTLLQTLSVNARDAAIVESALLGMTLLPVSE
SSTEHGVWDNTKAPREGSVASLLQGQVYPEFLNQIQLLGQAQRFTPEQGWWMAVDDEGNL
YGENFKVSKSKQTSLGLLTQQTQLNELNDELPKLIADVEQTKTQKEVLQTRLQAAQQEIE
SNSANIHQIAQGMAKAQTHSELLEKQHANWQRTLEQYQQKQDSLQAQLNEQTAPITEQKQ
QIADIEAALELLQAQQIELQAQADEQEQAYIQAASHSQTAQQALHQAELELQKVQNTWQL
EQTKQQHSQSVLNSALERLETLQQQLEDQQLPLLECEEQLMVLVEQHQEIEIQLEQCQTQ
KAQAQKALQDKQASLQDAQSGVTKKQNQLQQLKLAEQELMIKAQLMLEPLQELQQTLKDI
LTSLPETPKLVSFQSKLQNTTKQLLDLGAVNLAAIEEYDQALERKTYLDEQLDDLTAALE
TLEGAIRKIDRETKLRFKQTFDQVNKDFAGLFPKVFGGGQAYLELTSDDLLETGVAIMAR
PPGKKNSTIHLLSGGEKALTALSLVFSIFRLNPAPFCMLDEVDAPLDDANVVRFCRLVEE
MSQSVQFIYISHNKIAMEMAGRLTGVTMAEPGVSRMVAVDIEQAVQMAQT
NT seq 3393 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgacccatattaagcttgcaggctttaaatcatttgttgagcccagcaagatc
ccatttccagatcagatgacctgtgtggtcggcccaaatggctgtggtaagtctaacgtc
attgatgccgtgcgctgggtgttgggtgaaagctcagctaagaacctgcgtggcgatgcc
atgacagacgttatttttaacggctcaacacaccgtaaaccggtctcccaagcttcggta
gaacttttctttgataatacttcaggtgtgttacaaggcagtcttgctaatcgaaatcaa
atcgccattaagcgtctagtaactcgtgatggtcagtcactatattttctcaatggtagc
aaatgtcgtaaacgtgatattaccgacattttcttaggcacaggccttgggccgcgtagc
tatgcgattatcgagcaggggatgatctctcgcttaattgaaagccgcccacaagagctc
agagtatttttagaagaagcagctggtgtttctaagtacaaagagcgacgtcgcgaaacg
caaacccgtattcaaagtacccgtgataatttagagcgcttgctagacatgcgccaagag
ctgaaaaatcagcttgataaactctcggtgcaagcagagcaagccaaacaatatcgtgag
cttaagcgagatgagcgtttgctcaaaggccaagtcgcagtcataaaatggcaaaagcta
aatgcacaacaacaacaaaaagcggccgaaattgctgaacttgaaaaacaaattcgcttt
tttagtgacgcccatcaaggccatgctgatgtgctctcagcattagaagcaaagcttgag
caagacactcataaactagaagaaacacaacaacaaaagcatcgcattcatactgagata
attcgctttgaacagcaaaaactcagtgcacagcaacaaaagacgcaactacaagctgat
atagataaacaaaagcaagcatttaaagaagcgcaagacgcgctgcaaacccttcaacag
gcgcaaacggagtttaccgagcaacaacaagcggcagagcaagggcttgagcaagtgaaa
gacgtgttattaaaagcgcaaagtgcctttgaatcgtcacaggctgctcataaagcacag
caaacgaagttaactgcgggtcaacatgagatatcggagcagcgccaagcacttcagcaa
gcagagcaaaactgtaagcaagcagagttatccctgactcatttgcaagaaaatatagca
gatgtggcaaagcaaattgaacagcagcaaagtcaatcagtcacaaaagagctcgatgca
gcaaaagccgagtttaatcagcttgcgaaacaaatggcagggcttcaatcgcagggcaag
caactggctgtggctttagatgaagcacagactaattatacaaaggccgagcttgaagag
cgcgagagtgcgcaaaagatcagtagctacaaagcaaatatcagtgcgttagagaatgtg
ctgaactcactgaccgatgacgtaaagcagacgttactgcaaaccttatccgttaatgcg
agagatgcagcgattgttgaaagtgcgctgcttggcatgactttattacctgtgagcgaa
agcagcactgagcatggtgtttgggataacaccaaagcgcctcgcgaaggctcagttgca
agtttattgcaggggcaggtttaccctgaatttttaaaccagatccaattacttgggcaa
gctcagcgatttacccctgagcaaggctggtggatggctgttgatgacgagggcaacttg
tatggagagaactttaaggttagtaagtctaaacaaacctctttgggcttattaacacag
caaacgcaattaaacgaacttaacgacgaattaccaaaactaatcgcagacgttgagcaa
acaaaaacgcaaaaagaagtcttacaaacacgtttacaagcagcacaacaagaaatagag
agtaatagtgccaatattcaccaaatcgctcagggtatggcgaaggcacaaactcactcc
gagttattagaaaagcaacatgctaattggcagcgaacactagagcaatatcaacaaaag
caagactcgcttcaagcacaattaaatgagcaaacagcgcctattaccgaacaaaaacaa
cagattgcggacatagaagctgctcttgagttactgcaagcgcagcaaattgagttacaa
gctcaggccgacgaacaagaacaggcatacattcaggctgcaagtcactcgcaaacggct
cagcaagcattgcatcaggcagagcttgagttacaaaaagttcaaaatacgtggcaactt
gagcaaacaaaacagcaacacagtcaaagcgtgttaaatagcgccctagagcgtcttgaa
accttacaacagcaattagaagatcaacaactgccactgctagagtgtgaagagcagttg
atggttttagttgagcagcatcaagaaatcgaaattcagctagagcagtgccaaacacaa
aaagcacaagcccaaaaagcactgcaagataaacaagcgagtttgcaagacgcgcaatcg
ggcgtaacaaaaaaacaaaatcagcttcaacagctaaaattagcagagcaagagctaatg
attaaagcacagctgatgctagagccccttcaagagttgcagcaaacactcaaagatatt
ctgacaagtttgccagaaacccctaagctggtgagcttccagtcaaagttacaaaacacc
accaagcagttattggacttaggcgcggttaaccttgctgcgattgaagagtatgaccaa
gcacttgagcgcaaaacatatttagacgagcaattggatgatctaactgccgcactcgaa
acgcttgaaggcgctattcgtaaaatagaccgagaaaccaagctgcgctttaagcaaacc
tttgatcaagtaaataaagactttgcaggcttgtttccgaaagtgtttgggggcggtcaa
gcctatcttgagttgacctcagatgacctgttagaaaccggtgtcgcgattatggcaagg
ccgccaggcaagaaaaactcaacaattcacctcttaagtggtggagaaaaagcgctgacc
gcattatcattagtgttttcaatatttaggctaaatccagcgccattttgtatgctggat
gaagttgatgcaccgcttgatgacgccaacgtcgtacgtttttgccgtttggtcgaagaa
atgtcacaatcggtgcaatttatatatattagtcacaataaaatcgccatggaaatggcg
ggtagactgacgggggtgaccatggccgaaccgggtgtttcgcgtatggttgccgtagac
atagaacaagcagtgcaaatggcacaaacgtag

DBGET integrated database retrieval system