KEGG   Pseudoalteromonas phenolica: PP2015_2844Help
Entry
PP2015_2844       CDS       T04165                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pphe  Pseudoalteromonas phenolica
Pathway
pphe00250  Alanine, aspartate and glutamate metabolism
pphe00410  beta-Alanine metabolism
pphe00430  Taurine and hypotaurine metabolism
pphe00650  Butanoate metabolism
pphe01100  Metabolic pathways
pphe01110  Biosynthesis of secondary metabolites
pphe01120  Microbial metabolism in diverse environments
pphe02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pphe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PP2015_2844
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PP2015_2844
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PP2015_2844
   00430 Taurine and hypotaurine metabolism
    PP2015_2844
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PP2015_2844
Enzymes [BR:pphe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PP2015_2844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 Aminotran_1_2 UPF0175
Motif
Other DBs
NCBI-ProteinID: ALO43329
UniProt: A0A0S2K4U2
LinkDB All DBs
Position
I:complement(3241749..3243374)
Genome map
AA seq 541 aa AA seqDB search
MGPKRCAVASDETLMRIFTVPEAPDSTLSKIELEISNNLVGFLNENIAAIEKPLHEVEKD
FQSAAIPEQPMFVSDYAQDIMEQLVAHSVHTASPSFIGHMTSALPHFVLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYGADESFYGKWMHSAKTSLGAFCSGGTVANITAL
WIARNRLLQPQGDFKGINSQGLVAAMMHYGYKGLAVLVSERGHYSLGKAADVLGIGRDNF
IAIKTSDDNKVDVQAMREKALELEAQGIKVMALVGVAGTTETGNIDPLSDMADLAQELNC
HFHVDAAWGGATLLSANARPLLAGIERADSITIDAHKQMYVPMGAGMVLFKDPHATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRQGYEMLIDKGIAKAKYFAELI
KQEEDFELVSEPELCLLTYRYVPKAIKQAIANANEDEKIDIYAALNRFTASMQKRQREAG
RSFVSRTRLTPVQYDNQPTVVFRVVLANPLTSEAMLKEILDEQKQLAKTDPIFKKYLAKY
I
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctaagcgttgtgctgtagcttctgatgaaactttaatgcgtatatttacggtg
ccggaagcgccagattcaactttaagtaagattgaactggaaatctccaataatttggtg
ggctttttaaacgagaatattgctgcaattgaaaaacctttgcacgaagtggaaaaagat
tttcagtcggctgctattccagaacagcccatgtttgtgtctgattatgcccaagatata
atggagcagcttgtcgcgcattcggtgcatacagcttcacctagcttcattggtcatatg
acatctgctttgccacattttgttttacctttgtcaaaattaatggtggggttaaaccaa
aatttagtaaaaatcgaaacctccaaagcatttacgccactagaacgccaagtattaggg
atgatgcaccatcttgcttatggtgctgatgaatctttttatggcaaatggatgcacagt
gcaaaaacgtcgttaggtgcgttttgctcgggcggaacagttgccaatatcacagcactt
tggattgctcgaaatcgtctgttacaaccgcaaggtgattttaaaggcattaatagtcaa
ggtctggtcgctgccatgatgcactatggctataaaggtttggcggtgttagtgtctgag
cgaggacattactctctgggcaaagcggcagatgtactaggtattggccgcgataacttt
attgctataaaaaccagcgatgataacaaagttgatgttcaggctatgcgtgagaaagcg
ttagagcttgaggcacaaggcataaaggtcatggcgttagtgggggttgctggcacaacc
gagacaggtaatattgacccccttagtgatatggccgacttagctcaagagttaaactgt
cactttcatgttgatgcggcttggggtggagcgactttgttatcggcgaatgcccgcccg
ttgttagctggtattgagcgtgcagattcaatcaccattgacgcgcataaacaaatgtat
gtgccaatgggcgccggtatggtgctatttaaagacccgcatgctactgatgcgattgag
catcacgccgaatatattcttcgtaaaggctctaaagacttggggagtcatacgcttgag
ggaagccgtccaggcatggcgatgcttgtacatgcatgcttacgtgtgattggtcgtcaa
ggctatgaaatgcttatcgataagggcattgcaaaggcgaaatattttgcagagcttatc
aaacaagaggaagattttgagttagtgtcagaacctgagttatgtttgttaacttaccgt
tatgtaccgaaggcaattaagcaggcaatcgccaatgcgaatgaagacgagaaaatcgac
atttatgctgcattaaaccgattcacggcaagcatgcaaaagcgtcagcgtgaagctggg
cgttcatttgtctctcgtactcgtttaacgcctgtacaatatgataatcagcctacggtt
gttttcagagttgtgttagctaatccattaacctctgaagctatgcttaaagagattcta
gacgagcaaaagcaattagcgaaaacagatcctatcttcaaaaagtatttagctaagtat
atttaa

DBGET integrated database retrieval system