KEGG   Pseudoalteromonas phenolica: PP2015_3340
Entry
PP2015_3340       CDS       T04165                                 

Definition
(GenBank) preprotein translocase subunit Tim44
  KO
K03397  indoleacetate---lysine synthetase [EC:6.3.2.20]
Organism
pphe  Pseudoalteromonas phenolica
Brite
KEGG Orthology (KO) [BR:pphe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PP2015_3340
Enzymes [BR:pphe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.20  indoleacetate---lysine synthetase
     PP2015_3340
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: ALO43815
UniProt: A0A0S2K5P0
LinkDB
Position
I:complement(3795925..3797163)
AA seq 412 aa
MNNERDTLSLRHSAFDRKRIQAIVNKFWALSFPSEKAPKISDYESFVNLVPEMGKEQYIA
LSEKVFANHKDVPLIIGGSSGTSGQSKLVIEKTNTPGSKPSEDDVQLITELRMAGVLGPG
DIAANLFMVGMYSILHHGFNRIIEACYASVLPLGMLNPEQTDTQLAFMKKHKVNVLTGTP
GTLIQVAHAVQASGVDLKIERILYTGERLGEAKAKVLRAVFPGVRIIGFYGLSECGFMAI
EEQGEKYKVRQNAYFLEINDAGRLLVTCLNDELPMPFLRFDTGDAVSLTARGDQVIMAGI
DRSDTSFNFVGNLVDVRELRQIAAAAIGESDIIIEALLDTNQQGQDLLTIRVLSHMLSKE
DEVVIADALLSYEEVKEALDKNTGIVTVEFDTPQSATLTGRNKHRQILDKRA
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaacaatgaaagagatacactttcattacgccatagtgcgtttgataggaaaagaatt
caggcaattgtgaacaagttttgggcattaagttttccatctgaaaaagcgcctaagatt
agtgattatgagtcttttgtaaacctagtcccagaaatgggtaaggaacaatacatcgcg
ttgtctgagaaggtgtttgcaaaccataaagacgtgccattaatcattggtggttcaagt
ggtacttcagggcaaagcaagttagtcattgaaaaaacgaatacaccgggctcaaaacca
agcgaagacgatgttcaattgatcactgaactaagaatggctggtgtattgggtcctgga
gacatagctgcaaacctgtttatggtaggtatgtattctattttgcatcatggttttaat
cgaattattgaagcatgttatgcctcagtattgcctttaggcatgctaaacccagagcaa
acggatacgcagttagcatttatgaagaagcataaagtcaatgtattaacgggcacgcca
ggcacgctaattcaagtggcacatgctgttcaagcaagtggtgtagatctaaaaatagag
cggatcttatacacaggtgagcgccttggtgaagcaaaggcgaaggtgcttagagcggtg
ttccctggcgtacgcattattggtttttatggtttgtcagaatgtggatttatggcaatc
gaggagcagggtgaaaagtataaagttagacaaaatgcttatttcctagaaatcaatgat
gcaggtcgattactcgttacttgtttaaacgacgaattaccaatgccatttttacgcttt
gataccggagatgccgtatcgctgacagcacggggtgatcaagtgattatggctggtatt
gatagatctgatacgagtttcaacttcgtcggaaacttagtggatgttcgcgagttacgc
caaattgcagctgcagccattggtgagtcagacattattatcgaagcacttctcgatact
aatcagcaaggacaagacttactgacgattcgagtgctgagccacatgttgtctaaagaa
gatgaagtggtgatcgctgatgctttgcttagctatgaagaagttaaagaggctttagac
aaaaatacgggaattgtgacagtcgaattcgatacaccacagagtgcgactttaactggc
cgtaataagcaccgacagattctagataagcgagcttaa

DBGET integrated database retrieval system