KEGG   Pannonibacter phragmitetus: APZ00_02305Help
Entry
APZ00_02305       CDS       T04214                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00380  Tryptophan metabolism
pphr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pphr00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    APZ00_02305
Enzymes [BR:pphr01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     APZ00_02305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ALV26050
UniProt: A0A0U3NZN5
LinkDB All DBs
Position
complement(502202..503431)
Genome map
AA seq 409 aa AA seqDB search
MSGTSSVHPLDQGDPLGPKRAAFALPEGVIYLDGNSLGTLPAHVPQRVADVVSKQWGESL
IRAWNEHDWVDLPRRVGDRIGRLVGAAPGTVIAGDSTSINLFKVLSAALAMRSERKVILS
DTGNFPTDLYMAQGLRDLLNAGHELRLVAPEEVADAITDEVAVIMITQVDYRTGRRHDMA
ALTRLAHEAGALAIWDLAHSAGAFKVELDACGADFAIGCGYKYLNGGPGAPAFLYVAERH
QAVARQPLNGWMGHDAPFAFDLDYRGARGVDQFRVGTPPILSLSALDAALDVFDDVDMDV
LRGKSVSLCELFIKEVESRCEGLELASPRNADERGSQVSFRFAEGYALMQALIARGVIGD
FRAPDIVRFGFTPLYLSHGDVVKAVDILADILATRSWDAPQFKTRAKVT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaacatccagcgttcatccgcttgatcagggcgatccgcttgggcccaagcgt
gccgcctttgccctgcccgagggcgtcatctatctggatggcaactcccttggcacgttg
cccgcccatgtgccgcagcgggtggctgatgtggtgagcaagcagtggggcgaaagcctc
atccgcgcctggaatgagcatgactgggtggatctgccgcgccgtgtgggcgaccggatc
ggccgtctggtgggcgcggcgcccggcacggtgattgccggtgacagcacgtcgatcaac
ctgttcaaggtgctttcggctgctcttgcaatgcgctcagagcgcaaggtgatcctctcc
gacacgggcaacttcccgacggatctttacatggcgcagggcctgcgggacctgctgaat
gccggtcatgagctgcgtcttgtcgcgccggaagaggttgcggatgccatcacggacgag
gtcgcggtgataatgatcacccaggtcgactaccgcacgggccgccgtcatgacatggcg
gcgctgacccgccttgcccatgaggctggagctcttgctatctgggatctcgcccattcc
gccggtgccttcaaggtggaactggatgcctgcggcgccgattttgccatcggctgcggc
tacaagtatctgaacggcggcccaggtgctccggctttcctctatgtggcagagcggcac
caggccgttgcccgccagccgctgaacggctggatgggccacgatgcgcccttcgcgttc
gatctcgattaccgcggcgccaggggcgtcgaccagttccgcgtcggcacgccgccgatc
ctgtcgctctccgccctcgatgcggcgctggatgtgtttgacgatgtagatatggacgtg
ctgcgggggaagtccgtttccctgtgcgaactgttcatcaaggaggtggaaagccgctgc
gagggtctggaactggcgagcccgcgcaatgcggatgagcgcggcagccaggtctccttc
cgctttgccgagggctatgccctgatgcaggcactgatcgcacgcggtgtgatcggcgat
ttccgcgcaccggatatcgtccgcttcggttttaccccgctctatctctctcacggcgat
gtggtgaaggctgtcgatattctggcggacattctcgccacccgcagctgggatgcaccg
cagttcaagacccgcgccaaggtgacctga

DBGET integrated database retrieval system