KEGG   Pannonibacter phragmitetus: APZ00_02445Help
Entry
APZ00_02445       CDS       T04214                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00250  Alanine, aspartate and glutamate metabolism
pphr00410  beta-Alanine metabolism
pphr00640  Propanoate metabolism
pphr00650  Butanoate metabolism
pphr01100  Metabolic pathways
pphr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pphr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    APZ00_02445
   00650 Butanoate metabolism
    APZ00_02445
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APZ00_02445
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APZ00_02445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pphr01007]
    APZ00_02445
Enzymes [BR:pphr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     APZ00_02445
Amino acid related enzymes [BR:pphr01007]
 Aminotransferase (transaminase)
  Class III
   APZ00_02445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALV29816
UniProt: A0A0U3NAA4
LinkDB All DBs
Position
531448..532725
Genome map
AA seq 425 aa AA seqDB search
MQNSQIAARRAAAISRGVGVTTQVYAHKAENAEIWDVEGRRYIDFAAGIAVVNTGHRHPK
VIEAVKAQLDSFTHTCHQVVPYENYVALAEKLNAAVPGDFAKKTIFVTTGAEAVENAVKI
ARAATNRPAVIAFTGGFHGRTFMGMTLTGKVQPYKAGFGAMMPDVFHVPFPVELHGVSVE
DSLSVLDKLFKADVDPARVAAFIVEPVQGEGGFYEVPRAFMEKLQEIARKHGILLIADEV
QTGFARTGKLFAMEHYGVVPDITTMAKGLGGGFPIAAVTGRAEIMDAPAPGGLGGTYGGN
PIGVAAGLAVLEVIEEEGLCERAVSLGNRLKQRLSGLAASIPQIADVRGPGFMNAVEFNI
PGTSTPDAEFTNRVREKALERGLILLTCGVYGNVIRFLAPVTIPDDVFSEALDILEAALL
SAKEG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattctcagatcgcggcccggcgggctgctgccatttcgcgcggtgtcggcgtg
acgacgcaggtctatgcccacaaggccgagaacgccgagatctgggatgtggaaggccgc
cgctacatcgactttgccgcaggcatcgccgtggtcaacaccggccaccggcacccgaag
gtgatcgaggccgtgaaggcgcagctcgacagcttcacccacacctgccaccaggtcgtg
ccttacgagaactacgtggcactggccgaaaagctgaatgccgccgtgcccggcgatttt
gccaagaaaaccatcttcgtcaccaccggcgccgaggcagtggaaaatgccgtcaagatt
gcccgcgccgccacgaaccggcccgccgtcatcgccttcaccggcggcttccatggccgc
accttcatgggcatgacgctgaccggcaaggtacagccctacaaggccggctttggcgcc
atgatgccggacgtgttccacgtgcccttccccgtcgagctgcatggcgtttccgttgag
gattcgctctccgtgctcgacaagctgttcaaggccgatgtggacccggcgcgcgttgcc
gccttcatcgtcgagcccgtgcagggcgagggcggcttctatgaagtgccgcgcgccttc
atggagaagctgcaggagatcgcccgcaagcacggcatcctgctgattgccgacgaagtg
cagaccggctttgcccgcaccggcaaactcttcgccatggagcattacggcgtggtgccg
gacatcaccaccatggccaagggccttggcggcggtttcccgattgccgccgtcaccggc
cgcgccgagatcatggatgcccctgcccccggcggccttggcggcacctatggcggcaac
ccgattggcgttgccgcaggtcttgccgtgctggaagtaatcgaggaagagggcctgtgc
gaacgcgccgtcagccttggcaaccggctgaagcagcgcctctccggccttgccgccagc
attccgcagatcgccgatgtgcgcggccccggcttcatgaatgcggtggagtttaacatt
ccgggaacctcgacaccggacgcagagttcaccaaccgggtgcgcgaaaaggcactggag
cgcggcttgatcctgctcacctgcggcgtctacggtaatgtcatccgtttccttgcgccc
gtcaccattcccgatgatgtgttcagcgaggcgctggacattctcgaagccgcgcttctc
agcgcgaaggaaggctga

DBGET integrated database retrieval system