KEGG   Pannonibacter phragmitetus: APZ00_09850Help
Entry
APZ00_09850       CDS       T04214                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00564  Glycerophospholipid metabolism
pphr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pphr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    APZ00_09850
Enzymes [BR:pphr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     APZ00_09850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ALV27326
UniProt: A0A0U3FMA0
LinkDB All DBs
Position
2135925..2137553
Genome map
AA seq 542 aa AA seqDB search
MSGFRRLVPVTSQQDQVVDLFIIGGGINGCGIARDAAGRGLSVALAEMNDLASATSSAST
KLFHGGLRYLEYFEVRLVREALIERETLLEAMPHISWPMRFVLPYHKDMRFEGETPTSKL
LNMVMPWMKGRRPAWLIRFGLFLYDNLGGRKILPGTTTVNLKSGPEGEPLQDRFAKAYEY
SDCWIEDSRLVVLNARDAEARGAEVMVRTRVVSAERVDGLWSIVLEDCGTGARTSRKAKM
LINAGGPWVGDVIRNTVRSNSQESVRLVRGSHIVTKKLFDHGKCYFFQGEDGRIIFAIPY
ETDFTLIGTTDADHPEPGVKPVCTEKERDYLLKFASGYFKRPVTVDDIVWSYSGVRPLYN
DGAKSATAATRDYVLKVEETGGAPLLNVFGGKITTYRKLAEHALEKIVPYFPGTAGAWTA
RVPLPGGDFPVLGVAKLIADLRAAYPFLDERWATRLVKAYGTEAAGILAGAAKVEDLGRH
FGWNLTEREVNWLIEKEYARTAEDVVWRRSKLGLRLSAAEVAALDAWMKSTCALRLGEAA
AQ
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtttcaggaggctcgtgcccgtgacgtcgcagcaagaccaggtggtcgatctc
tttatcatcggcggcggcatcaatggctgcggcattgcccgtgatgcggcggggcgcggc
ctgtccgtggcgctggcggagatgaacgacctggcatctgccacctcttcggcctccacc
aagctgttccatggcgggttgcgctatctcgaatatttcgaggtccggctggtgcgcgag
gcgctgatcgagcgggaaacgctgctggaggcaatgccgcacatcagctggccgatgcgt
ttcgtgctgccctatcacaaggacatgcgctttgagggcgaaacgccgacctcgaagctg
ctgaacatggtgatgccctggatgaagggccgccgcccggcatggctgatccgcttcggc
ctgttcctttatgacaatctgggcggccgcaagatcctgcccggcaccacgacggtcaat
ctgaaatccggccctgagggtgaaccgcttcaggaccgctttgccaaggcctatgaatat
tccgactgctggatcgaggattcgcgccttgtggtgctgaatgcccgtgacgctgaggcg
cgcggcgccgaggtgatggtgcgcacccgtgtggtctccgctgagcgcgtggatggcctg
tggtcgatcgtgctggaagactgcggcaccggcgcccgcaccagccgcaaggcaaagatg
ctgatcaatgccggtggcccctgggtcggggacgtgatccgcaacaccgttcgctccaat
tcgcaggaaagcgtgcgcctcgtgcgcggcagccacatcgtcacgaagaagctcttcgac
cacggcaagtgctactttttccagggcgaagatggccgcatcattttcgccattccctac
gagacggatttcacgctgatcggcaccacggatgccgaccatccggagccgggcgtcaag
ccggtctgtacggagaaggagcgcgactatctgctgaaattcgcttccggctatttcaag
cgcccggtgacggttgatgatatcgtctggagctattccggtgtgcgcccgctctacaat
gacggcgccaagtcggcgacggcggcgacccgcgattacgtgctgaaggtggaagagact
ggcggtgcgccgctgctcaatgtcttcggcggcaagatcaccacctaccgcaagctcgcc
gagcatgcgctggagaagatcgtgccctatttccccggcacggccggggcatggacagcc
cgtgtgccgcttccgggcggtgactttccggtgctgggcgttgcgaagctgattgcggat
ctgcgcgccgcgtatccgttcctcgacgagcgctgggccacgcgcctggtgaaggcatat
ggcaccgaggcggcgggtattctggctggagcggcaaaggtggaggaccttggccgtcac
ttcgggtggaacctgaccgagcgggaagtcaactggctgattgaaaaggaatacgcgcgc
accgccgaggacgtggtgtggcgccggtcgaaactgggcctgcgtctgagtgctgccgag
gtggcggcactggacgcgtggatgaagagtacctgcgcgctgcggcttggggaggctgca
gctcagtag

DBGET integrated database retrieval system