KEGG   Pannonibacter phragmitetus: APZ00_12105Help
Entry
APZ00_12105       CDS       T04214                                 

Definition
(GenBank) ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00910  Nitrogen metabolism
pphr02010  ABC transporters
Module
pphr_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:pphr00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    APZ00_12105
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    APZ00_12105
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pphr02000]
    APZ00_12105
Transporters [BR:pphr02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    APZ00_12105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ALV27714
UniProt: A0A0U3P4G1
LinkDB All DBs
Position
2601840..2602736
Genome map
AA seq 298 aa AA seqDB search
MPQIQLKMKDAAIRKATASVIAFTRPMKTSSHFTRAQALARSASETLLPPVITLAVLLAI
WQVLCSSPTSSLPAPSKVLSESWEIIAHPFYEGQGIDQGMFWQILASLQRVAVGYAFSVV
VGIGLGVLVGSSQWAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDGNPSAIFVIFITAVWP
IIINTAVGIRNIPQDYQNVVRVLRLNGFEYFAKIMLPAAAPYIFTGLRIGIGLSWLAIVA
AEMLIGGVGIGFFIWDAWNSSLISDIIVALVYVGVVGFFLDRLIAFAGRLVTRGTATA
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccccagatccagctgaagatgaaggacgccgcgatacgcaaggcaacggccagcgtc
atcgcctttacccgccccatgaagacaagcagccatttcacccgcgcccaggcgcttgcc
cgcagtgcgtcagaaacgctgctgccgcccgtgatcaccctcgccgtgcttctggccatc
tggcaggtgctgtgctcctcgccgacctccagcctgccggccccttccaaggtgctgtcg
gaaagctgggagatcattgcccatccgttctatgaagggcagggcatcgatcagggcatg
ttctggcagatccttgccagcctgcagcgcgtggctgtcggctatgccttctccgttgtg
gtgggcatcggccttggcgtgctcgtcggctccagccagtgggcgatgcggggtctcgat
ccgatcttccaggtgctgcgcaccgtgccgccgctggcctggctgcccctgtcgctggcc
gcctttcaggatggcaacccgtcagccatcttcgtcatcttcatcaccgccgtctggccg
atcatcatcaacacggcggtcggcatccgcaacattccgcaggactatcagaacgtggta
agggtgctgcggctgaacgggttcgagtatttcgccaagatcatgctgccggctgccgcg
ccctacatcttcacgggcctgcgcatcggcatcggcctgtcctggctcgccatcgtggcc
gcggaaatgctcatcggcggcgtcggcatcggcttcttcatctgggacgcatggaactcg
tcgctgatcagcgacatcatcgtcgccctcgtctatgtcggggtcgtcggcttcttcctt
gaccgtctcatcgcctttgcaggccgcctcgtcacccgcggcaccgcgaccgcctga

DBGET integrated database retrieval system