KEGG   Pannonibacter phragmitetus: APZ00_13585Help
Entry
APZ00_13585       CDS       T04214                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00240  Pyrimidine metabolism
pphr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pphr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    APZ00_13585
Enzymes [BR:pphr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     APZ00_13585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: ALV27973
UniProt: A0A0L0IUJ2
LinkDB All DBs
Position
complement(2941977..2942567)
Genome map
AA seq 196 aa AA seqDB search
MAKLYFNYSSMNAGKSTVLLQASYNYVERGMRTLLLTAAVDDRAGVGRISSRIGLVAEAD
IFRAGDNLLDHIRKAHEAAPIDAVFVDEAQFLTEDQVWQLAHASDRLGMPVMCFGLRTDF
QGKLFPGSKALLALADSLKEIKTICWCGRKATMVARLDGSGRIVEEGEQVVIGGEESYVS
LCRRHWVDRDLGPRCD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctctatttcaactactcctccatgaatgccggcaaatcgacggtgctgctg
caggcctcctacaactatgtggaacggggcatgcgcaccctgctgctgacggctgcggtg
gatgaccgggcgggcgtcggacgcatttcctcccgcatcggccttgtggcagaggcggat
attttccgcgccggcgacaacctgctcgaccatatccgcaaggcccatgaagccgccccc
attgacgcggtgtttgtcgatgaggcgcagttcctcaccgaagaccaggtgtggcagctg
gcccatgcctccgaccggctcggcatgccggtcatgtgcttcggcctgcgcacggatttt
cagggcaagctcttcccgggcagcaaggccctgctggcgctggccgacagtctgaaggaa
atcaagaccatctgctggtgcggccgcaaggcaaccatggtcgcacggcttgacggcagc
ggacggatcgtcgaggaaggcgagcaggtggtgattggcggcgaagagtcctatgtttcc
ctttgccgccgccactgggtcgaccgtgacctcgggccgcgctgcgactga

DBGET integrated database retrieval system