KEGG   Pannonibacter phragmitetus: APZ00_14385Help
Entry
APZ00_14385       CDS       T04214                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00473  D-Alanine metabolism
pphr00550  Peptidoglycan biosynthesis
pphr01100  Metabolic pathways
pphr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pphr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    APZ00_14385
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    APZ00_14385
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    APZ00_14385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pphr01011]
    APZ00_14385
Enzymes [BR:pphr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     APZ00_14385
Peptidoglycan biosynthesis and degradation proteins [BR:pphr01011]
 Precursor biosynthesis
  Amino acid ligase
   APZ00_14385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 RimK ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ALV30109
UniProt: A0A0U3PS14
LinkDB All DBs
Position
3131543..3132469
Genome map
AA seq 308 aa AA seqDB search
MTGKHVAVLMGGWAHERPVSLSSGNACADALEARGFRVSRVDVDRSIAARLAELKPDVAF
NALHGPFGEDGCIQGLLEILNIPYTHSGVMASALAMNKVKAKAVMAAHGVPVTEHLIINR
RDVGHEHPMRPPYVIKPINEGSSFGVLIVKEDQLHPPQELTRDDWPYPDTMMCETYIPGR
ELTCAVMGDEALGVIDIVPKGHGFYDFEAKYAEGGSVHILPAKISPFIYQEVQKLTLTAH
RALGCRGVSRADFRFDERPDGSGTLICLEVNTQPGMTPTSLVPELAAYTGRDFGDLVTWM
VEDASCSR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtaagcatgtcgcggtactgatgggcgggtgggcgcacgagaggccggtgagc
ctttcgtccggcaatgcctgcgccgatgcgctggaagcgcgcggcttcagggtgtcgcgc
gtcgatgttgaccgttccatcgcagcccgtctggccgaactgaagccggatgtggccttc
aatgccctgcatggccccttcggcgaggatggctgcatccagggcctcctcgagatcctg
aacattccctacacgcattccggcgtgatggcctctgcccttgccatgaacaaggtgaag
gccaaggccgtgatggcggcgcatggggtgccagtcacggaacatctgatcatcaaccgg
cgggatgtggggcatgagcacccgatgcgcccgccctatgtgatcaagccgattaacgaa
ggctccagcttcggcgtgctgatcgttaaggaagaccagttgcatccgccgcaggagctg
acgcgcgatgactggccatatccggacacaatgatgtgcgagacctacattcctggccgc
gagctgacctgcgcggtgatgggagatgaggcgcttggagttatcgacattgtcccaaaa
gggcacggtttctacgattttgaagcgaaatatgcggaaggtggctctgttcacatcctt
cctgcgaaaatttcaccctttatttaccaagaagtacagaaacttaccttaacagcgcat
cgtgcgctcggctgccggggtgtttcgcgggcggatttccgcttcgatgagcgtccggat
gggtcgggtaccctgatctgcctggaagttaacactcaacctggaatgaccccaacctcg
ctggttccggaacttgccgcctacactggccgtgatttcggggatctcgtcacctggatg
gtggaggacgcaagttgctctcgctga

DBGET integrated database retrieval system