KEGG   Pannonibacter phragmitetus: APZ00_18070Help
Entry
APZ00_18070       CDS       T04214                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00010  Glycolysis / Gluconeogenesis
pphr00020  Citrate cycle (TCA cycle)
pphr00620  Pyruvate metabolism
pphr01100  Metabolic pathways
pphr01110  Biosynthesis of secondary metabolites
pphr01120  Microbial metabolism in diverse environments
pphr01130  Biosynthesis of antibiotics
pphr01200  Carbon metabolism
Module
pphr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pphr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APZ00_18070
   00020 Citrate cycle (TCA cycle)
    APZ00_18070
   00620 Pyruvate metabolism
    APZ00_18070
Enzymes [BR:pphr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     APZ00_18070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N ATP-synt_ab_Xtn Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ALV28724
UniProt: A0A0U3PWV7
LinkDB All DBs
Position
3953696..3955039
Genome map
AA seq 447 aa AA seqDB search
MPINITMPALSPTMEEGKLAKWLVKEGDKVSPGDVIAEIETDKATMEVEAVDEGTVAKIV
VAAGTQGVKVNTLIAVLAGEGEDASAAAAAPAAAPAKAEAAPAKAEAAAAPAASAPAAAA
PAPVSASGERIFASPLARRLASQNGLDLKAIAGSGPHGRIVQRDIEAALKSGTGKAAPAT
AAAPAAPAEAPKAAAAAAPAGPSKEQVLKLFAEGSYELVPHDGMRKTIAKRLTESKQTIP
HFYVSLDCELDALLALRTQLNDAAPKSKDGKPAYKLSVNDMVIKAMALALRDVPDANVSW
TDDAMVKHKHADVGVAVSIPGGLITPIIRSAEQKALSTISNEMKDLGQRAKDRKLKPEEY
QGGTTAVSNMGMMGVKSFSAVVNPPHATILAVGAGEQRPVVRNGALAVATVMTVTLSTDH
RCVDGALGAELLGAFKGYIENPMSMLV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacatcacaatgccggccctctctcccaccatggaagagggcaaactggcc
aagtggctggtgaaggaaggtgacaaggtttctcccggcgacgtgatcgccgagatcgaa
accgacaaggcgaccatggaagtggaagccgtggacgagggcacggtcgccaagatcgtg
gtcgccgccggaacgcagggcgtcaaggtcaataccctgatcgccgtgctcgccggtgaa
ggcgaggacgcatctgcagccgctgccgctccggccgctgcacccgccaaggcggaagca
gctccggccaaggctgaagccgctgctgctccggccgcttctgcgccggctgctgccgct
ccggctccggtcagtgcatcgggcgagcgcatctttgcctcgccgcttgcccgccgtctg
gcgtcgcagaacggtctggacctcaaggccatcgcaggctccggcccgcatggccgtatc
gtccagcgcgatattgaggctgcgctgaagtccggcaccggcaaggcagctccggctact
gccgccgctcctgccgctcctgccgaggctccgaaggccgctgccgctgcagcgcccgcc
ggtccttccaaggagcaggtgctcaagctcttcgccgaaggctcctacgagctggtgccg
cacgacggcatgcgcaagaccattgccaagcgcctcaccgagtccaagcagacgatcccg
cacttctatgtgtcgctcgactgcgaactcgacgcgcttctggccctgcgcacccagctc
aacgacgcggctccgaagtccaaggacggcaagccggcctacaagctctcggtcaatgac
atggtcatcaaggccatggcgctggccctgcgcgatgtgccggatgcgaacgtctcctgg
acggacgatgccatggtcaagcacaagcacgccgatgtcggcgtcgccgtgtcgatcccg
ggcggcctgatcaccccgatcatccgcagcgccgagcagaaggccctgtccaccatctcc
aacgagatgaaggacctgggtcagcgcgccaaggaccgcaagctgaagccggaagagtac
cagggcggcaccaccgccgtgtccaacatgggcatgatgggcgtgaagagcttctcggcc
gtggtcaacccgccgcatgccaccattctggcagtcggcgcgggcgagcagcgtcctgtc
gtcaggaatggcgctctggctgtggccaccgtcatgacggtgacgctctccaccgaccac
cgctgcgtggacggcgctctgggcgcggaacttctcggcgccttcaagggctacatcgag
aacccgatgagcatgctggtctga

DBGET integrated database retrieval system