KEGG   Pannonibacter phragmitetus: APZ00_20980Help
Entry
APZ00_20980       CDS       T04214                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pphr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    APZ00_20980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pphr02000]
    APZ00_20980
Enzymes [BR:pphr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     APZ00_20980
Transporters [BR:pphr02000]
 Other Transporters
  Pores ion channels [TC:1]
   APZ00_20980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ALV29217
UniProt: A0A0U3ECF6
LinkDB All DBs
Position
complement(4609307..4609966)
Genome map
AA seq 219 aa AA seqDB search
MSDSKLILHYAPRSRSSTIRVLMDELGMPYDLHVLNMRAGELKSPAYRAINPLGKVPALQ
HGDTIVTEAIAIALYLADLYPQAGLTPALTDPRRGEYMRWMVFYAASFEPAVVDRAVGNV
IPPETAPYGSYDKVMEILAAHLEGAPYMLGDRISVADIIWGAAFRWLLMFKLVPELPVFT
EYAGRITSRPSFQAVLADEVRLDAEHEAAAAALAAARAG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacagcaagctgatccttcattatgcccctcgcagccgctccagcaccatccgc
gtgctgatggatgagctcggcatgccctatgacctccatgtcctcaatatgcgggcaggc
gaattgaagtcgccggcctatcgggcgatcaacccgctgggcaaggttccggcgctgcag
catggcgatacgatcgtcaccgaagccattgccatcgcgctctatctggctgatctctat
ccgcaggccggactgacgccggcgcttaccgatccgcgccgcggcgaatacatgcgctgg
atggtcttctatgccgcttccttcgagccggctgtcgtcgacagggctgtgggcaatgtg
atcccgccggaaacggcgccttacggctcatatgacaaggtgatggagatccttgcggcg
catctggagggggctccctacatgctgggggaccggatctcggtggccgatatcatctgg
ggcgcagccttccgctggctcctgatgttcaagctggtgccggagcttccggtcttcacg
gaatatgccggacggatcaccagccgtccgagcttccaggccgttttggccgatgaggtc
cggctggacgccgagcatgaggcagctgctgcggcccttgccgcggcgcgcgcaggctga

DBGET integrated database retrieval system