KEGG   Pseudomonas putida ND6: ND057
Entry
ND057             CDS       T02170                                 

Gene name
nahB
Definition
(GenBank) naphthalene cis-dihydrodiol dehydrogenase
  KO
K14582  cis-1,2-dihydro-1,2-dihydroxynaphthalene/dibenzothiophene dihydrodiol dehydrogenase [EC:1.3.1.29 1.3.1.60]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00624  Polycyclic aromatic hydrocarbon degradation
ppi00626  Naphthalene degradation
ppi01100  Metabolic pathways
ppi01120  Microbial metabolism in diverse environments
ppi01220  Degradation of aromatic compounds
Module
ppi_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    ND057 (nahB)
   00624 Polycyclic aromatic hydrocarbon degradation
    ND057 (nahB)
Enzymes [BR:ppi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.29  cis-1,2-dihydro-1,2-dihydroxynaphthalene dehydrogenase
     ND057 (nahB)
    1.3.1.60  dibenzothiophene dihydrodiol dehydrogenase
     ND057 (nahB)
SSDB
Motif
Pfam: adh_short_C2 adh_short NmrA NAD_binding_10 Epimerase
Other DBs
NCBI-ProteinID: AAP44290
UniProt: Q6XUJ5
LinkDB
Position
pND6-1:57826..58653
AA seq 275 aa
MVTATAVTINQRECTCMGNQQVVSITGAGSGIGLELVRSFKSAGYYVSALVRNEEQEALL
CKEFKDALEIVVGDVRDHATNEKLIKQTIDRFGHLDCFIANAGIWDYMLSIEEPWEKISS
SFDEIFDINVKSYFSGISAALPELKKTNGSVVMTASVSSHAVGGGGSCYIASKHAVLGMV
KALAYELAPEVRVNAVSPGGTVTSLCGPASAGFDKMHMKDMPGIDDMIKGLTPLGFAAKP
EDVVAPYLLLASRKQGKFITGTVISIDGGMALGRK
NT seq 828 nt   +upstreamnt  +downstreamnt
atggtcactgcaaccgcggtcaccattaatcaaagggaatgtacgtgtatgggcaatcaa
caagtcgtttcgataaccggtgcaggctcaggaatcggtctcgaactggttcggtccttt
aagtcggccggttattacgtatccgctctcgtacgaaacgaggagcaagaggcgcttctt
tgcaaagagttcaaggacgcactcgagattgtagtgggcgatgtccgggaccacgcaaca
aatgagaagctgataaagcaaacaatcgatagattcggtcatcttgattgttttattgca
aatgccggtatctgggattacatgctgagcatcgaagagccttgggagaaaatatcgagc
agttttgacgaaatattcgacattaatgtcaagagctatttcagtggcatcagtgccgcc
ctgccggaactgaaaaagactaacggatcagtggtgatgaccgcttcggtgtcgtcccat
gcggtcggtggtggtggttcttgctacatcgccagcaagcatgcggtgctcggtatggtt
aaggctttggcctacgaattggcccccgaagttcgcgtgaacgctgtttcgccggggggc
accgtgacgtctctgtgcggtcccgcgagcgccggtttcgacaaaatgcacatgaaagac
atgcccggcatcgacgatatgatcaaaggtctcacgcctcttgggtttgcagccaagccc
gaagacgtggtggcaccctatttgttgctggcttcgcgaaagcaaggaaaattcatcacc
ggcaccgtgattagcattgatggcggtatggcgctcggtcgcaagtga

DBGET integrated database retrieval system