KEGG   Pseudomonas putida ND6: ND058
Entry
ND058             CDS       T02170                                 

Gene name
nahF
Definition
(GenBank) salicylaldehyde dehydrogenase
  KO
K00152  salicylaldehyde dehydrogenase [EC:1.2.1.65]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00626  Naphthalene degradation
ppi01100  Metabolic pathways
ppi01120  Microbial metabolism in diverse environments
ppi01220  Degradation of aromatic compounds
Module
ppi_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    ND058 (nahF)
Enzymes [BR:ppi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.65  salicylaldehyde dehydrogenase
     ND058 (nahF)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AAP44291
UniProt: Q6XUJ4
LinkDB
Structure
PDB: 
4JZ6

Position
pND6-1:58700..60151
AA seq 483 aa
MKTKLFINNAWIDSSDQQTFERIHPVSSDVVTESANATVTDAIKAAQAAEEAFKTWKAVG
PSERRRLLLKVADVMESKTPKFIEVMAMEVGASALWAGFNVHASANVFREAASLATQIQG
ETIPTDKAETLSMTLRQPVGPILSIVPWNGTAVLAARAIAYPLVCGNTVVFKGSEFSPAT
HALITQCVQEAGLPAGVLNYLNSSPDRSPEIADALISAKEIRRINFTGSTRVGSIIAQKA
AQHLKRCLLELGGKSPLIVLDDADIDAAVKAAVFGSFLFQGQICMSTERLIVDEKIADEF
VAKFVEKTKRLSAGDPCVTGDCIIGPMVSPNSGERINGLFKDAIDKGAKVVCGGLAQGAL
MPATILDHVKSDMRIYDEETFGPITVVIRCKGEAEAVRIANDSVYGLSSGVFGRDINRAL
RVGMSIEYGSVHINGSTVQNEAQAPYGGTKNTGYGRFDGRAVIDEFTEIKWLTIEPFEQQ
YPF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaagacaaaactgtttatcaataacgcctggatcgattctagtgaccagcagaccttc
gagcgcatacaccccgtcagcagcgatgtggtgactgagagcgcaaacgccacagtgacg
gacgcgataaaggcggcgcaagcggccgaggaggcgttcaagacctggaaggccgttgga
ccttcagagcgtcgccgccttctcctaaaggtcgccgatgtcatggaaagtaaaacaccc
aagttcatcgaagtgatggccatggaggtgggagcttccgccctttgggccggattcaac
gtccatgcgtctgccaatgtgttccgagaggctgcctcgctggctacccaaattcagggt
gaaaccatcccaacggacaaagccgaaacgctctcaatgacactacgtcagccggtcggc
ccgatcctaagcatcgttccatggaacggcaccgcagtgcttgcggcacgagccatcgct
tatccgctggtctgtggcaacactgtggtgttcaaaggctctgaatttagtcccgcgacg
catgccctgatcacccagtgcgtgcaggaagccgggctgcccgctggcgtgctcaattac
ctcaactcttcgcctgaccgttcgcccgagatcgctgacgcactgatctctgccaaggag
atccgccgcatcaacttcacgggttccacccgcgtgggcagcattatcgcgcagaaagcc
gcgcaacacctcaagcgctgcctgctggagctcggcggcaagtccccgcttattgttctg
gatgatgcagacatcgatgcggcggtcaaggcagcggtgttcggtagcttcctgttccaa
ggtcagatctgcatgtccactgagcgcttgatcgttgatgagaagatagccgacgaattt
gtcgcaaaatttgtcgaaaaaactaagcgcttgagcgcaggcgacccgtgcgtaactggc
gactgcatcatcggcccgatggtctcgccaaattcgggtgagcggatcaatggtttgttc
aaagacgcgatcgacaaaggggcaaaagttgtttgcggcggcttggcccaaggtgcgctc
atgccggccacgatcctggatcacgtcaaatctgacatgcggatttacgatgaggagacc
tttggtcccatcaccgtggtaatccgttgtaaaggcgaagcagaggccgtccgcattgcc
aacgacagcgtctatggcctgtcgtcgggcgtatttggccgcgacatcaaccgcgctcta
cgcgtgggtatgtccatcgaatatggttctgtacacatcaacggttcgaccgtccagaac
gaggcgcaggctccttacggaggcaccaagaacaccggctacgggcgcttcgacggccgt
gctgtaatcgacgagttcacagagatcaagtggctgaccatcgaacctttcgagcagcaa
tatcccttctga

DBGET integrated database retrieval system