KEGG   Pseudomonas putida ND6: YSA_02421Help
Entry
YSA_02421         CDS       T02170                                 

Definition
(GenBank) cobalamin synthase
  KO
K02233  adenosylcobinamide-GDP ribazoletransferase [EC:2.7.8.26]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00860  Porphyrin and chlorophyll metabolism
ppi01100  Metabolic pathways
Module
ppi_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YSA_02421
Enzymes [BR:ppi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.26  adenosylcobinamide-GDP ribazoletransferase
     YSA_02421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobS
Motif
Other DBs
NCBI-ProteinID: AFK68078
UniProt: I3URF7
LinkDB All DBs
Position
complement(1307868..1308590)
Genome map
AA seq 240 aa AA seqDB search
MLPFWIALQFLSSLPVSLPGMPAPRDVGRSLLYYPLVGLLFGLLLWLASHLLQGTPSPLH
AALLLTLWVLLSGALHLDGLADSADAWLGGFGDRERTLRIMKDPRSGPIAVVTLVLVLLL
KFCALWVLVGQGIGAQLLLAPLIGRAAMLGLFLGTPYVRPGGLGQALAEHLPRRAAGWVL
LVCVLFCLFLGGWSVLLALAVFAWLRHLMCRRLGGTTGDTAGALLELLELAVVLGLALGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgttctggattgccctgcagtttctcagcagcctgccggtgagcctgccgggc
atgccggcaccgcgtgacgtagggcgttcgctgctgtactacccgctggtcgggttgctg
ttcggcttgctgctgtggttggccagtcatctgcttcagggcacgccgtcgccgctgcac
gcggctttgctgctgacactgtgggtactgctcagtggtgccttgcacctggatggcctg
gcggacagtgccgacgcctggctaggtggtttcggcgaccgtgagcgcaccttgcggatc
atgaaagacccgcgcagtgggccgattgccgtggtcaccctggtcttggtgttgttgctg
aagttttgcgcactgtgggtgctggtcgggcagggcatcggcgcgcaattactgctggcg
ccgttgatcgggcgggcggcgatgttgggcctgttccttggcacaccttatgtgcgacct
ggcgggttgggccaggcgttggctgaacatttgccccggcgcgcggcggggtgggtgttg
ctggtttgtgtgctgttctgcctcttcctgggcggatggagcgtgctgctggcgctggcg
gtgtttgcctggttgcggcatctgatgtgccggcgcctgggcgggaccaccggtgatacc
gccggtgcgttgctggagctgctggagctggccgtcgtgctcgggttggcgctggggctt
tga

DBGET integrated database retrieval system