KEGG   Pseudomonas putida ND6: YSA_03725Help
Entry
YSA_03725         CDS       T02170                                 

Definition
(GenBank) peptidoglycan glycosyltransferase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00550  Peptidoglycan biosynthesis
ppi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YSA_03725
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    YSA_03725
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppi01011]
    YSA_03725
Enzymes [BR:ppi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     YSA_03725
Peptidoglycan biosynthesis and degradation proteins [BR:ppi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   YSA_03725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AFK68780
UniProt: I3UTF9
LinkDB All DBs
Position
complement(1994417..1996306)
Genome map
AA seq 629 aa AA seqDB search
MSQPIRLKDHEKDARLVRNRVVVGAVAIMLLVCVLIARLYYLQIIQYDYHSTLSENNRVH
VQPIPPTRGLIFDRNGVIVADNRPSFSLSMTRERAGNWQEVLDTIVEVLELTADDRALFE
KRMRQGRRPFEPVPILFELNEEQIARVAVNQFRLPGVEVVAQLVRHYPQGAHFAHSVGYV
GRINEKELKTLDPVNYSGTHHIGKTGIERFYEAALHGQVGYEEVETNARGRVLRVLKRTD
PKPGKDIVLSLDIKLQEAAEAALGGRRGAVVALDPRTGEVLAMVSQPSFDPNLFVTGISF
KAYAELRDSIDRPLFNRVLRGLYPPGSTIKPAVAIAGLDSGVVNASSRVFDPGYYQLPNY
DHKYRNWNRSGDGWVDLDTAIMRSNDTYFYDLAHKMGIDRLSSYMNKFGIGQRVSLDMFE
ESAGLMPSREWKRATRRQAWFPGETLILGIGQGYMQATPLQLAQATALIANKGVWNRPHL
AKTIEGLPPVDDNPMEDIVLRDKSDWAKVTHGMEQVMHNARGTARKAAAGAQYRIAGKSG
TAQVVAIKQGEKYDRNKLQERHRDHALFVAFAPAEAPKIVVSVMVENGESGSGVAAPVVR
QIMDAWLLDENGRLKPEFAPATVTQESAL
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagccgatccgtctcaaggaccacgagaaagacgcccgcctggtgcgcaaccgc
gtcgtggtcggcgcagtggcgatcatgctgcttgtctgcgtgttgatcgcacggctgtac
tacctgcagatcatccagtacgactaccactccacgctgtcggagaacaaccgggtgcat
gtgcagccgatcccgccgacccgcgggctgatcttcgaccgcaacggggtgatcgttgcc
gacaaccggcccagcttcagcctgtcgatgacccgcgaacgtgcgggtaactggcaggaa
gtgctggataccatcgtcgaagtgcttgagctcaccgctgacgaccgtgccctgttcgag
aagcgcatgcgccaaggccgccggccattcgagccggtgccaatcctgttcgagctcaac
gaagagcagattgcccgcgtggcggtaaaccagttccgcctgccgggtgtcgaggtggtg
gcccagttggtgcggcattacccgcagggtgcgcatttcgcccattcggtgggttatgta
gggcggatcaacgagaaagagctgaaaacgctcgacccggtgaactacagcggtacccac
catatcggcaagaccggcatcgagcgcttctacgaggccgccctgcacggtcaggtgggt
tacgaggaagtcgagaccaacgcccgtggccgtgtgctgcgggtgctcaagcgcaccgac
ccgaagccgggcaaggacattgtgctgagcctggacatcaagctgcaggaggccgctgaa
gccgccctgggaggccggcgtggtgcagtggttgcgctcgacccgcgcaccggcgaggta
ctggcgatggtgagtcagcctagtttcgaccccaacctgttcgtcaccggcatcagcttc
aaggcctatgccgaattgcgcgattcgatcgatcggccgctgttcaaccgcgtgctgcgt
ggcctgtacccgccggggtcgaccatcaagccggcggtggctattgccggtctggacagt
ggcgtcgtgaatgccagcagcagggtgttcgaccctggctactaccagttgcccaactac
gaccataaataccgtaactggaaccgctccggtgatggctgggtcgacctggacaccgcc
atcatgcgctcgaacgacacctacttctatgaccttgcgcacaagatgggcatcgatcgg
ttgtccagctacatgaacaagttcggtatcggccagcgggtatccctcgatatgttcgag
gaatctgccgggttgatgccgtcgcgcgaatggaagcgcgccactcgccgccaggcctgg
ttccccggcgaaaccctgattctcggcatcggccagggttacatgcaggccacgccgctg
cagctggcccaggccactgcattgatcgccaacaaaggtgtgtggaaccgcccacacctg
gccaagaccatcgaaggcctgccgccggtggacgacaaccccatggaagacatcgtgctg
cgtgacaagtccgactgggccaaggtcacccatggcatggaacaggtgatgcacaacgcc
cgcggtaccgcgcgcaaggcagctgccggtgcccagtaccgcattgccggcaagagcggc
accgcccaggtggtggcgatcaagcagggcgagaagtatgaccgcaacaaactccaggag
cgccaccgcgaccatgccttgttcgtcgcgtttgccccagccgaagccccgaaaatcgtg
gtttcggtgatggtcgagaacggtgagtccggctcgggtgtcgccgctccggtggttcgc
cagatcatggacgcctggctgctcgacgaaaacggccggctcaaacccgagttcgcgccc
gccaccgttacccaggaatcggccctgtga

DBGET integrated database retrieval system