KEGG   Pseudomonas putida ND6: YSA_06956Help
Entry
YSA_06956         CDS       T02170                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00970  Aminoacyl-tRNA biosynthesis
ppi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YSA_06956
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ppi03029]
    YSA_06956
Enzymes [BR:ppi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     YSA_06956
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     YSA_06956
Mitochondrial biogenesis [BR:ppi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    YSA_06956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AFK70518
UniProt: I3UYE7
LinkDB All DBs
Position
complement(3758326..3759771)
Genome map
AA seq 481 aa AA seqDB search
MQWEVVIGLEIHTQLATQSKIFSGSATTFGSEPNTQASLVDLGMPGVLPVLNEEAVRMAC
MFGLAIDAEIGKRNVFARKNYFYPDLPKGYQISQMDLPIVGKGHLDIALEDGTIKRIGVT
RAHLEEDAGKSLHEDFSGSTGIDLNRAGTPLLEIVSEPDMRSAKEAVAYVKAIHALVRYL
GICDGNMAEGSLRCDCNVSIRPKGQTEFGTRCEIKNVNSFRFIERAINSEIQRQIDLIED
GGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPDPDLLPVVIEDSFLETIRAGLPELPP
QKVERFQTQYGLSAYDANVLASSREQADYFEEVVKIGGDAKLAANWVMVELGSLLNKLGV
EIDQAPVSAAQLGGMLLRIRDNTISGKIAKTVFEAMAAGEGDADSIIESKGLKQVTDTGA
IDKMLDEMLAANAEQVEQYRAADEAKRGKMFGFFVGQAMKASKGKANPGQVNQLLKAKLE
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgggaagttgtgatcgggctggaaatccacactcagctcgccacccagtcgaag
atcttctccggcagcgctaccacctttggctccgagccgaatactcaggccagcctggtt
gacctgggcatgcccggtgtactgccggtgctgaacgaggaagccgtgcgcatggcgtgc
atgttcggcctggccatcgatgccgagatcggcaagcgcaacgtgttcgcacgcaagaac
tacttctaccccgacctgcccaagggctaccagatcagccagatggacttgccgatcgtc
ggcaagggccacctggacatcgcgctggaagacggcaccatcaagcgcatcggcgtaacc
cgcgcgcacctggaagaagacgccggcaagagcctgcacgaagacttcagcggctccacc
ggcatcgacctgaaccgtgccggcaccccgctgctggaaatcgtctccgagcctgacatg
cgcagcgccaaggaagccgtggcttacgtcaaggcaatccacgcgctggtgcgctacctg
ggcatctgcgacggcaacatggccgaaggttcgctgcgctgcgactgcaacgtatcgatc
cgaccgaaaggccagaccgagttcggcactcgctgcgaaatcaagaacgtcaactcgttc
cgtttcatcgagcgcgcgatcaacagcgaaatccagcgccagatcgacctgatcgaagac
ggtggcaaagtcgtgcaggaaacacgcctgtacgacccgaacaaggacgaaacccgctcc
atgcgcagcaaagaggaagctaacgactaccgttacttccccgaccccgacctgctgccg
gtggtcatcgaggacagcttcctcgaaaccattcgcgccggcctgccggagctgccgcca
cagaaggtcgagcgcttccagactcagtacggtctgtcggcctacgacgccaacgtgttg
gcttccagccgcgaacaggctgactacttcgaagaagtggtaaagatcggtggtgatgcc
aagctggcggccaactgggtcatggtcgaactgggtagcctgctgaacaagctgggtgtc
gaaatcgatcaggcgccggtcagcgccgcgcagttgggcggcatgctgctgcgcattcgt
gacaacaccatcagcggcaagattgccaagaccgtgttcgaggccatggccgccggtgaa
ggcgatgccgacagcatcatcgagagcaaaggcctgaaacaggttaccgatacgggtgcg
atcgacaagatgctcgacgaaatgctggcagccaatgccgagcaggtcgaacaatatcgc
gcagccgatgaggccaagcgcggcaagatgttcggcttcttcgtcggtcaggccatgaaa
gcttccaaaggcaaggccaacccggggcaggtgaaccaattgctcaaggccaagctcgaa
gggtga

DBGET integrated database retrieval system