KEGG   Pseudomonas putida ND6: YSA_06957Help
Entry
YSA_06957         CDS       T02170                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00970  Aminoacyl-tRNA biosynthesis
ppi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    YSA_06957
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ppi03029]
    YSA_06957
Enzymes [BR:ppi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     YSA_06957
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     YSA_06957
Mitochondrial biogenesis [BR:ppi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    YSA_06957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFK70519
UniProt: I3UYE8
LinkDB All DBs
Position
complement(3759783..3761234)
Genome map
AA seq 483 aa AA seqDB search
MHQLTLAEIARGLADKSFSSEELTGALLARIKQLDPQINSFISITDDLALAQARAADARR
AAGETGALLGAPIAHKDLFCTNGVRTSCGSKMLDNFKAPYDATVVAKLAEAGMVTLGKTN
MDEFAMGSANESSHYGAVKNPWNLEHVPGGSSGGSAAAVAARLLPATTGTDTGGSIRQPA
ALTNLTGLKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCALLLQGMAGFDAKDSTSIEE
PVPDYSASLNASLQGLRIGLPKEYFGAGLDPRIADLVQASVKELEKLGAVVKEISLPNMQ
HAIPAYYVIAPAEASSNLSRFDGVRFGYRCEEPKDLTDLYKRSRGEGFGVEVQRRIMVGT
YALSAGYYDAYYVKAQQIRRLIKNDFMAAFNDVDLILGPTTPNPAWKLGAKSSDPVAAYL
EDVYTITANLAGLPGLSMPAGFVDGLPVGVQLLAPYFQEGRLLNVAHRYQQVTDWHTRAP
NGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaattgaccctggccgagatcgcccgcggactcgccgacaaatcgttttcttcc
gaagagctgaccggcgccctgctggcgcgcatcaaacagctcgacccgcagatcaacagc
ttcatcagcatcaccgacgacctggccctggctcaggcgcgtgccgccgatgcccgtcgc
gccgctggcgaaaccggcgcgctgctgggtgcaccgatcgcccacaaagacctgttctgc
accaacggcgtacgcaccagctgcggctcgaagatgctcgacaacttcaaggcgccctat
gacgccaccgtggtcgccaagctggccgaagccggcatggtcaccctgggcaagaccaac
atggacgagttcgccatgggttcggccaacgaatccagccattacggcgcggtgaagaac
ccgtggaacctcgagcacgttccgggcgggtcgtccggtggttcggccgctgctgtggcc
gcgcgcctgctgcccgccaccacgggcaccgacaccggcggctcgatccgccagccagcg
gcactgaccaacctcaccggcctcaagccgacgtacggtcgtgtgtcgcgctggggcatg
atcgcctacgcctccagcctcgaccagggcggcccactggcccgcaccgccgaggactgc
gcgctgctgctgcaaggtatggccggtttcgacgccaaggactccaccagcatcgaagaa
ccggtgccggactacagcgccagcctgaacgcttcgctgcagggcctgcgcatcggcctg
ccgaaagagtacttcggtgccggtctagacccacgcatcgccgacctggtccaggccagc
gtcaaagagctggaaaagctcggcgcagtggtcaaggaaatcagcctgccgaacatgcag
catgccattccggcctactacgtgatcgccccggctgaagcctcttccaacctgtcgcgt
ttcgacggcgtacgcttcggctaccgctgtgaagagcccaaagacctcaccgacctgtac
aagcgctcacgcggcgaagggttcggcgttgaagtacagcgccgcatcatggtcggtacc
tacgccctgtcggccggctactacgacgcctattacgtgaaggcgcagcaaatccgccgc
ctgatcaagaacgacttcatggccgccttcaacgatgtcgacctgattctcggcccgacc
acgccaaacccggcctggaagcttggcgccaagagcagcgacccggttgccgcctatctc
gaagacgtctacaccatcaccgccaacctggcgggcctgcctggcctgtcgatgccagca
ggcttcgtcgacggcctgccggtcggcgtgcaactgctggcgccgtacttccaggaaggc
cgcctgctcaacgtcgcgcaccgctaccaacaggtgaccgactggcatacccgcgccccc
aacggcttctga

DBGET integrated database retrieval system