KEGG   Pseudomonas putida ND6: YSA_08437Help
Entry
YSA_08437         CDS       T02170                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00020  Citrate cycle (TCA cycle)
ppi00190  Oxidative phosphorylation
ppi00650  Butanoate metabolism
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01130  Biosynthesis of antibiotics
ppi01200  Carbon metabolism
Module
ppi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YSA_08437
   00650 Butanoate metabolism
    YSA_08437
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YSA_08437
Enzymes [BR:ppi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     YSA_08437
    1.3.5.4  fumarate reductase (quinol)
     YSA_08437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA HI0933_like FAD_binding_3 Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AFK71334
UniProt: I3V0R3
LinkDB All DBs
Position
4550951..4552723
Genome map
AA seq 590 aa AA seqDB search
MASIPTISFDAIIIGGGGAGMRAALQLAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCQEGPAAVFELDHMGLPFSRTETGRIYQRP
FGGQSKDFGKGGQAARTCAASDRTGHALLHTLYQGNLKAGTTFLNEYYAVDLVKNQDGAF
VGVIAICIETGETLYIKSKATVLATGGAGRIYASTTNALINTGDGIGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINAHGERFMERYAPNAKDLAGRDVVARSMVKEI
IAGNGVGPNKDHVLLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPVPVVPTCHYMMG
GVATNIHGQAITMDADGQDHIIPGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALSEGVEYRDASDTDVDVALNRLNKLNERTSGEDVASLKRELQSCMQNYFGVFRTGE
YMQKGIEQLAGLRDRIANVKINDKSQAFNTARIEALELQNLLEVAEATAIAAEARKESRG
AHAREDFEDRDDENWLCHTLYYPGEKRVAKRGVNFAPKTVPAFEPKVRTY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggctagcattccaaccatttccttcgacgccatcatcatcggtggcggcggcgccggc
atgcgcgcagcgctgcaactggctcaaggcggccacaagactgccgtagtcaccaaggtc
ttcccgacccgttcgcacaccgtatccgcccagggcggcatcacctgcgccattgcttcg
gccgacccgaacgacgactggcgctggcacatgtacgataccgtcaagggttccgactac
atcggtgaccaggacgctatcgaatacatgtgtcaggaaggcccggctgcggtcttcgaa
ctggaccacatgggtctgccgttctcgcgcactgaaaccggccgcatctatcagcgcccg
ttcggtggtcagtccaaggacttcggtaaaggtggccaggccgcccgtacctgtgccgct
tcggaccgtaccggtcacgcgctgctgcacaccctgtaccagggcaacctgaaagcgggc
accacgttcctcaacgagtactacgcagttgacctggtgaagaaccaggacggcgcattc
gtgggtgtgatcgccatctgcatcgaaaccggcgaaaccctgtacatcaagtccaaggcc
accgtactggccactggcggtgcaggccgtatctacgcgtccaccaccaacgccctgatc
aataccggtgacggtatcggcatggccctgcgtgcaggcgtgccggtgcaggacatcgag
atgtggcagttccacccgaccggtatcgccggcgccggtgtactggtcaccgaaggttgc
cgcggtgaaggtggctacctgatcaacgcccacggcgagcgcttcatggagcgttacgcg
ccgaacgccaaagacctggccggccgcgacgtggttgcccgttccatggtcaaggaaatc
atcgccggcaacggcgtgggcccgaacaaggaccacgtactgctgaagctggaccacctg
ggcgaggaagtgctgcacagccgcctgccaggtatctgcgaactgtccaagaccttcgcc
cacgtcgaccctgtggtcgcgccggtgccggtggttccaacctgccactacatgatgggc
ggcgttgccaccaacatccatggccaggccatcaccatggacgccgacggtcaggatcac
atcatcccgggcctgttcgccgtaggtgaagtggcgtgcgtatcggttcacggtgccaac
cgcctgggcggcaactcgctgctcgacctggtggtgttcggccgtgctgccggcctgcac
ctggagaaggcgctgagcgagggcgtggaataccgcgacgccagcgacaccgacgtcgat
gttgccctgaaccgcctgaacaagctcaacgagcgtaccagcggtgaagacgttgccagc
ctgaagcgcgagctgcagagctgcatgcagaactacttcggtgtattccgtactggcgaa
tacatgcagaagggtatcgagcaactggccggtctgcgtgaccgtatcgccaacgtcaag
atcaacgacaagtcccaggccttcaacaccgcgcgtatcgaagcgctggagctgcagaac
ctgctggaagttgccgaagctaccgccatcgcggcggaagcccgtaaagagtcccgcggc
gctcacgcccgtgaagacttcgaagaccgtgacgacgaaaactggctgtgccacaccctg
tactacccgggtgagaagcgcgttgccaagcgcggcgtcaactttgcgccgaagactgtt
ccagccttcgaaccaaaagtccggacttactaa

DBGET integrated database retrieval system