KEGG   Pseudomonas putida ND6: YSA_08439Help
Entry
YSA_08439         CDS       T02170                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00020  Citrate cycle (TCA cycle)
ppi00190  Oxidative phosphorylation
ppi00650  Butanoate metabolism
ppi01100  Metabolic pathways
ppi01110  Biosynthesis of secondary metabolites
ppi01120  Microbial metabolism in diverse environments
ppi01130  Biosynthesis of antibiotics
ppi01200  Carbon metabolism
Module
ppi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ppi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YSA_08439
   00650 Butanoate metabolism
    YSA_08439
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    YSA_08439
Enzymes [BR:ppi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     YSA_08439
    1.3.5.4  fumarate reductase (quinol)
     YSA_08439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: AFK71335
UniProt: I3V0R4
LinkDB All DBs
Position
4552735..4553439
Genome map
AA seq 234 aa AA seqDB search
MLKVEVYRYNPDTDSAPKMESFDVDTGGKDLMVLDVLALIKEKDEGFSYRRSCREGVCGS
DGMNMNGKNGLACITPLSAVVKGGKLVLRPLPGLPVIRDLVVDMSIFYKQYEKVKPFLQN
DTPAPAIERLQSPEDRDKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRFLAD
SRDTKTQERLASLDDPFSVFRCRGIMNCVNVCPKGLNPTKAIGHVRNMLLQSGT
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcgaagtttatcgttacaacccggacaccgactcggcgccaaaaatggag
tcgttcgacgtcgataccggcggcaaggacctgatggtgctggatgtattggcactgatc
aaggaaaaggacgagggtttctcgtaccgtcgctcctgccgtgaaggcgtttgcggttcc
gatggcatgaacatgaacggcaagaacggcctggcctgcatcaccccgctgtcggcggtc
gtgaagggcggcaagctggttctgcgtcctctgccaggcctgccggtcattcgtgacctg
gtggtcgatatgagcatcttctacaagcagtacgagaaggtgaagccgttcctgcagaac
gacaccccggccccggccatcgagcgcctgcagtcgccggaagaccgtgacaagctggac
ggcctgtacgagtgcatcctgtgcgcgtgctgctcgacttcctgcccgtcgttctggtgg
aacccggacaagttcctgggcccggcagccttgctgcaagcctaccgcttccttgccgac
agccgcgataccaagactcaggagcgcctggcgtccctggatgacccgttcagcgtattc
cgctgccgcgggatcatgaactgcgtaaacgtttgcccgaaaggtctgaacccgaccaag
gcaatcggtcacgtacgtaacatgctgctgcaaagcggcacctga

DBGET integrated database retrieval system