KEGG   Pseudomonas putida ND6: YSA_08677Help
Entry
YSA_08677         CDS       T02170                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00500  Starch and sucrose metabolism
ppi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YSA_08677
Enzymes [BR:ppi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     YSA_08677
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     YSA_08677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: AFK71463
UniProt: I3V142
LinkDB All DBs
Position
4722027..4725347
Genome map
AA seq 1106 aa AA seqDB search
MAKRSRPAAFIDDPLWYKDAVIYQLHIKSFFDSNNDGIGDFAGLISKLDYIAELGVNTLW
LLPFYPSPRRDDGYDIAEYKAVHPDYGSMADARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARHAKRGSKAREFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVLKAVIGVMRFWLDLGVDGLRLDAIPYLIERDGTNNENLAETHDVLKAIRA
EIDANYPDRMLLAEANQWPEDTRPYFGEGDGDECHMAFHFPLMPRMYMALAMEDRFPITD
ILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAEDRRARINLGIRRRLAPL
LQRDRRRIELLTSLLLSMPGTPTLYYGDELGMGDNIYLGDRDGVRTPMQWSPDRNGGFSR
ADPQRLVLPPIMDPLYGYQTVNVEAQSHDPHSLLNWTRRMLAVRKQQKAFGRGSLRTLTP
SNRRILAYIREYTDADGNTEVILCVANVSRAAQAAELELSQYADKVPVEMLGGSAFPPIG
QLPFLLTLPPYAFYWFLLASRDRMPSWHIQPTEGLPELTTLVLRKRMEELLQAPASDTLQ
STILPQYLPKRRWFAGKEGPIDAVRLCYGVRFGTATTPVLLSEIEVLSDGTATRYQLPFG
LLREEQIHTALPQQLALSRVRRTHQVGLITDAFVLEPFIHAVMQACQDGLRLPCGDGEGE
LRFECTEQLAGLALDEESEVRYLSAEQSNSSVVIGDRVVLKLIRRVNPGIHPELEMSAYL
TAAGFANISPLLAWVSRVDEQHAPHLLMIAQGYLSNQGDAWGWTQNTLERAIRDQMEPTR
NDAEAHTDALAELSGFAALLGQRLGEMHLLLAAPTEDPAFQPRPSDARDSERWRAQISTE
LTHALDLLAQHRDTLDSDSQSLVDDLQQQRDGLAQHIDTLSKQAQGGLLMRVHGDLHLGQ
VLVVQGDAYLIDFEGEPARPLEERRAKHSPYKDVSGVLRSFDYAAAMILRSASAVDLSEP
ARQARQRVARQYLHQSRHAFVEAYGLATAAMPHAWQHAEGERAALELFCLEKAAYEITYE
AENRPSWLAVPLHGLHGLISTWGESE
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgttcccgcccggcagccttcatcgacgacccgctttggtacaaggatgct
gtcatctatcagttgcacatcaagtcattcttcgactcgaacaacgatggcatcggtgat
ttcgccggcctgatcagcaagctcgactatatcgccgagctgggtgtcaacaccttgtgg
ctgctgccgttctatccctcgccacgccgtgacgacggctacgacatcgccgaatacaag
gccgtgcaccccgactacggcagcatggccgacgcccgccgtttcatcgccgaggcccac
aagcgcggcctgcgggtgatcaccgagctggtcatcaaccacaccagcgaccagcacccg
tggttccagcgcgcccgccacgccaagcgcggcagcaaggcgcgcgagttttacgtgtgg
tcggacgacgaccagaagtacgacggcacgcgcatcatcttcctcgacaccgaaaagtcc
aactggacctgggacccggtcgccggccagtacttctggcaccggttctattcccaccag
ccggacctcaatttcgacaacccgcaggtgctcaaggcggtgatcggcgtcatgcgcttc
tggctcgacctgggtgtagatggcctgcggctggacgcgatcccttacctgatcgagcgc
gacggcaccaacaacgaaaacctcgccgaaacccacgacgtgctcaaggcgatccgcgcc
gagatcgacgccaactaccccgatcgcatgctgctggccgaagccaaccagtggccggaa
gacacgcgcccgtacttcggtgaaggcgacggcgacgaatgccatatggccttccacttt
ccgttgatgccgcgcatgtacatggccctggccatggaagaccgcttcccgatcaccgat
atcctgcgccagaccccggaaatcccggccaactgccagtgggcgatctttttgcgcaac
catgatgaactgaccctggaaatggtcaccgaccgcgagcgcgactacctgtggaactac
tacgccgaagaccgccgcgcgcgcatcaacctgggcattcgccggcgcctggcgcccctg
ctgcagcgtgaccgtcggcgcatagagctgctgaccagcctgctgttgtcgatgcccggc
acgccaaccctgtattacggcgacgaactgggtatgggcgacaatatctatctgggtgac
cgcgatggcgttcgcacacccatgcagtggtcgccagaccgcaacggcggtttttcccgc
gccgacccgcaacgcctggtgctgccgccgatcatggacccgctctacggttaccagacc
gtcaacgtcgaggcgcaaagccacgatccgcattcgctgctgaactggacccggcgcatg
ctggcggtgcgtaagcagcagaaggcctttggccgcggcagcctgcgcaccctcacgccc
agcaaccggcgcatccttgcctatatccgcgagtacaccgacgctgacggcaataccgag
gtcatcctctgcgtggccaacgtgtcccgcgccgcccaggctgccgaactcgaattgtca
caatacgccgacaaagtaccggtggagatgctgggcggcagcgcgttcccgccaatcggc
caactgccgtttctgctgaccttgccaccttatgcgttctactggttcctgctggccagc
cgcgatcgcatgcccagctggcacatccagcccaccgaggggttacccgaattgaccaca
ttggtactgcgcaagcgcatggaagaactgctgcaagcccccgcaagcgatacgctgcaa
agcaccatcctgccgcagtacctgcccaaacgccgctggttcgccggcaaggaagggccg
atcgatgccgtgcgcctgtgttacggcgtgcgtttcggcaccgccaccacgccggtgttg
ctcagcgaaatcgaggtactcagtgacggcacggccacccgctaccagctgccgttcggc
ctgctgcgtgaggaacagatccacaccgcgctgccgcagcagctggcgttgtcgcgggtg
cgccgtacccaccaggttggcttgatcacagacgccttcgtccttgagccgttcattcac
gctgtgatgcaagcctgccaggatggactgcgtctgccgtgcggcgacggtgagggtgaa
ttgcgctttgaatgcacagagcagctggccggcctggcgctcgacgaggagagcgaagtg
cgctacctcagcgccgagcagtccaacagttcggtggtcatcggcgatcgcgtggtgctt
aaactgatccgccgggtcaacccgggtatccatccagagctggaaatgagtgcctacctg
accgccgccggctttgccaacatctcgccgctgctggcctgggtcagccgggtggacgag
caacacgcgccgcatctgctgatgattgctcagggttacctgagcaaccagggcgatgcc
tggggctggacccagaacacgctggaacgggccatccgcgaccagatggagcccacccgc
aacgacgccgaagcgcacactgacgcattggccgaactcagcggctttgccgccttgctt
ggccagcgcctgggcgagatgcacctgctgctggccgcccccaccgaagacccggccttc
cagccgcgccccagcgatgcgcgggacagcgagcggtggcgtgcacagatcagcaccgaa
ctgacccacgccctcgacctgctggcgcagcatcgcgacacgctggacagcgacagccag
tccttggtcgacgacctgcagcaacagcgtgacggcctggcccagcacatcgacaccctg
agcaagcaggctcagggtggcctgctgatgcgtgtgcacggcgacctgcacctgggccag
gtgctcgtggtgcagggtgatgcctacctcatcgattttgaaggtgaacccgcccggccc
cttgaagagcgccgggcaaaacacagcccctacaaggatgtcagcggcgtgctgcgttcc
ttcgactatgctgctgcgatgatcttgcgcagcgcgtctgcggtggacctttccgagccg
gcgcggcaagcccggcagcgggttgcccggcagtacctgcaccagtcccggcatgccttt
gtcgaagcctatgggctggccaccgccgccatgcctcacgcctggcagcacgccgagggt
gagcgcgcggcgctggaattgttctgcctggaaaaagccgcctacgagattacatacgaa
gccgaaaaccgtccgagctggctggccgtgcctttgcatggtctgcatggactgatcagt
acctggggagagtcagaatga

DBGET integrated database retrieval system