KEGG   Pseudomonas putida ND6: YSA_09436Help
Entry
YSA_09436         CDS       T02170                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00473  D-Alanine metabolism
ppi01100  Metabolic pathways
ppi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    YSA_09436
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    YSA_09436
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppi01011]
    YSA_09436
Enzymes [BR:ppi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     YSA_09436
Peptidoglycan biosynthesis and degradation proteins [BR:ppi01011]
 Precursor biosynthesis
  Racemase
   YSA_09436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFK71878
UniProt: I3V2A7
LinkDB All DBs
Structure
PDB: 

Position
5065163..5066305
Genome map
AA seq 380 aa AA seqDB search
MDNGTNALTVQNSNAWVEVSASALQHNIRTLQAELAGKSKLCAVLKADAYGHGIGLVMPS
IIAQGVPCVAVASNEEARVVRASGFTGQLVRVRLASLSELEDGLQYDMEELVGSAEFARQ
ADAIAARHGKTLRIHMALNSSGMSRNGVEMATWSGRGEALQITDQKHLKLVALMTHFAVE
DKDDVRKGLAAFNEQTDWLIKHAKLDRSKLTLHAANSFATLEVPEARLDMVRTGGALFGD
TVPARTEYKRAMQFKSHVAAVHSYPAGNTVGYDRTFTLARDSRLANITVGYSDGYRRVFT
NKGHVLINGHRVPVVGKVSMNTLMVDVTDFPDVKGGNEVVLFGKQAGGEITQAEMEEING
ALLADLYTVWGSSNPKILVD
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggacaacggtaccaatgccctgaccgtgcaaaacagcaatgcctgggtcgaagtcagc
gccagcgccctgcagcacaacatccgcacgctgcaggccgagctggccggcaagtccaag
ctgtgcgccgtgctcaaggccgatgcctatggccacggtatcggcctggtaatgccatcg
atcatcgcccagggcgtgccctgcgtggcggtggccagcaacgaggaggcccgcgtggtc
cgcgccagtggcttcaccgggcaactggtgcgggtacgcctggccagcctaagcgagctg
gaagatggcttgcagtacgacatggaagagctggtgggcagcgcggaatttgcccgccag
gccgatgccatcgccgcgcgccatggcaagaccttgcgcattcacatggcgctcaactcc
agcggcatgagccgcaacggggtggagatggccacctggtccggccgtggcgaagcgctg
cagatcaccgaccagaagcacctcaagctggtcgcgctgatgacccacttcgccgtggaa
gacaaggacgatgtccgcaagggcctggcggccttcaacgagcagaccgactggttgatc
aagcacgcgaagctcgaccgcagcaagctcaccctgcacgccgccaactcgttcgctacg
ctggaggtgccggaagcgcgcctggacatggtacgaacggggggcgcgctgttcggcgac
accgtgccggcgcgcaccgagtacaagcgtgcgatgcagttcaaatcgcacgtggctgcg
gtgcacagctatccggctggcaacaccgtgggctatgaccgcaccttcaccctggcccgt
gattcgcgcctggccaacattacggtcgggtactccgacggctaccgccgggtattcacc
aacaagggccatgtgctgatcaacggccaccgtgtgccggtggtgggcaaggtgtcgatg
aacacgctgatggtcgatgtcaccgacttccctgatgtgaaggggggcaacgaagtggtg
ctgttcggcaagcaggccgggggcgaaatcacccaggccgagatggaagaaatcaacggc
gcgttgctcgccgatctgtacaccgtatggggcagttccaacccgaagatcctcgtcgac
tga

DBGET integrated database retrieval system