KEGG   Pseudomonas putida ND6: YSA_09852Help
Entry
YSA_09852         CDS       T02170                                 

Definition
(GenBank) beta-ketoacyl synthase-like protein
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
ppi  Pseudomonas putida ND6
Pathway
ppi00061  Fatty acid biosynthesis
ppi00780  Biotin metabolism
ppi01100  Metabolic pathways
ppi01212  Fatty acid metabolism
Module
ppi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ppi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    YSA_09852
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    YSA_09852
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppi01004]
    YSA_09852
Enzymes [BR:ppi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     YSA_09852
Lipid biosynthesis proteins [BR:ppi01004]
 Fatty acid synthase
  Component type
   YSA_09852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFK72121
UniProt: I3V300
LinkDB All DBs
Position
5291079..5292290
Genome map
AA seq 403 aa AA seqDB search
MKQAVAIAGAGCVLPSGWGVEPFWAAATEGRSAITALNARRFSSERVVAFGQIQDQDHQR
SRQDLAQNLQRYCTPAVIWGVSAVRQALEEAGLADEPPDVRFGLYCCQGGYTHPSLESYA
ELLLGCRQDGVADMAAFAKRILQDRAQDPFLVLKGLSNCLLGVTSLALKLVGECNAYMQG
VAGNLAALREATAALQAGRIDAAIVVGAGSELDALALSGLVQAGVISANGSNTLLPFDLR
GTGGIAGEGAAALVLRRREDLPAGPQACLADMTAHASLGRLSLPDSPTDVLVCSGTGDAH
KDRVLCQTLALARASHITSGLAINGILSAAPSLVDLMLARCALQAQSVPPIAGLQQPVAN
LPFIQGAPHAASLAHCLVLNRDDNGFSAAYQVLYSAKVTQDCR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggcggtcgcgattgccggtgcgggttgcgtgttgcccagcggttggggtgtc
gagcctttctgggcggccgcaaccgaagggcgcagtgcaattacggcgctgaacgcccga
cggttcagcagcgaacgcgtggtggcgttcgggcaaattcaggatcaggaccaccaacgc
agccgacaagaccttgcacaaaaccttcagcgttactgcacgccggcagtgatctggggt
gtcagcgcggtacgtcaggcgttggaagaagccggtctggccgatgagccgccggatgtc
cgtttcggtttgtattgctgtcagggcggctacacccatccgtctctggaatcctatgcc
gagttgttgctcggctgtcggcaggacggcgtcgccgacatggcggcgttcgccaaacgg
atcctgcaagaccgtgcccaggacccttttctggtgctcaaaggcttgagcaactgcttg
ctgggtgtcaccagcctggcgctgaaactggtgggtgagtgcaacgcctatatgcaaggt
gtcgccggcaacctggcagccttgcgtgaggctacggccgctttgcaggctggccgcatt
gacgcggcaatcgttgtcggtgcgggcagcgagctggatgccctggcgctgtccgggttg
gtccaggcgggtgtcatcagtgccaatggctctaacacgctgctgccgtttgaccttcgg
ggcaccggcggcattgccggggagggcgcggcagcattggtgctgcgccggcgcgaagac
ctgccggccggtcctcaggcgtgcctcgccgacatgacggcccatgcctccctcggtcgc
ttgagcctgcccgacagcccaaccgatgtgttggtgtgcagcggcaccggcgatgcgcac
aaagaccgcgtgttgtgccagacgctggcccttgcgcgcgcctcgcacatcaccagcggg
ttggcgatcaacggcattctcagcgcggcgccgagcctggtggatctgatgctggcgcgt
tgcgcattgcaggcccaaagcgtgccgccgattgccggtttgcagcaaccagtggcgaac
ctgccgtttatccagggcgcgcctcacgccgcgagccttgcgcattgcctggtgctgaac
cgcgacgacaacggattcagcgccgcctatcaagtgctctacagcgcaaaggtcactcag
gactgccgctga

DBGET integrated database retrieval system