KEGG   Phaeobacter piscinae: PhaeoP14_00278Help
Entry
PhaeoP14_00278    CDS       T05105                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component SucA
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
ppic  Phaeobacter piscinae
Pathway
ppic00020  Citrate cycle (TCA cycle)
ppic00310  Lysine degradation
ppic00380  Tryptophan metabolism
ppic01100  Metabolic pathways
ppic01110  Biosynthesis of secondary metabolites
ppic01120  Microbial metabolism in diverse environments
ppic01130  Biosynthesis of antibiotics
ppic01200  Carbon metabolism
Module
ppic_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppic_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PhaeoP14_00278 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    PhaeoP14_00278 (sucA)
   00380 Tryptophan metabolism
    PhaeoP14_00278 (sucA)
Enzymes [BR:ppic01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PhaeoP14_00278 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ATG38410
UniProt: A0A291FK34
LinkDB All DBs
Position
complement(307158..310115)
Genome map
AA seq 985 aa AA seqDB search
MTDQSPNELFHASSFMQGHNAEYLEQLYAQYANDPNAVDAAWAEFFRQMGDAELDVKAEA
AGPSWARADWPPAPNDDLTGALTGEWPAPAEAKGAGKKIKDQAAAKGVEVTDDQVQRAVL
DSIRALMLIRAYRIRGHLAANLDPLGMREEAQHPELDPRTYGFTEADMDRPIFIDNVLGL
QVASMRQIVSIVKRTYCGTFALQYMHISDPEQASWLKERIEGYDKEIRFTREGRKAILNK
MVEAEGFEKFLHVKYMGTKRFGLDGGESLIPAMEQIIKRGGALGIRDIVIGMPHRGRLSV
LANVMQKPYKAIFNEFQGGSFKPEDVDGSGDVKYHLGASSDREFDGNTVHLSLTANPSHL
EAVNPVVLGKVRAKQDQLKDSERTKVLPILLHGDAAFAGQGVVAECFALSGLRGHKAGGT
MHIVVNNQIGFTTAPHFSRSSPYPTDNALVVEAPIFHVNGDDPEAVVHAARVATEFRQKF
HKDVVLDIFCYRRFGHNEGDEPMFTNPLMYKKIKGHKTTLSLYTERLVKDGLIPEGEIED
MKASFQARLNEEFEAGKNFKPNKADWLDGRWSHLDKKDTDYQRGQTSVSPETFKEVGTAL
SRVPEGFPVHKTIGRFLDARAKMVDSGEGIDWATGEALAFGSLLTEGYPVRLSGQDATRG
TFSQRHSGIVNQNTEERYYPLNNIRSGQSHYEVIDSALSEYAVLGFEYGYSLAEPNALTL
WEAQFGDFANGAQIMFDQFISSGESKWLRMSGLVCLLPHGFEGQGPEHSSARLERFLQMC
GQDNWIVANCTTPANYFHILRRQLHRTFRKPLILVTPKSLLRHKLAVSKAEEFTTGSSFH
RVLWDDAQHGNSDTKLVADDKIKRVVLCSGKVYYDLLEERDARGLDDVYLMRIEQYYPFP
AISLVKELERFKGAEVVWCQEEPKNQGAWSFIEPNIEWVLTRIGAKHSRPTYVGRATSAS
PATGLASEHKAQQAALVNEALSIEG
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccagagccctaacgaactcttccatgcttcctccttcatgcaggggcacaat
gctgagtatcttgagcagctctatgcccaatacgccaatgatcccaacgcggtggatgcc
gcctgggctgagttctttcggcagatgggtgacgcagaacttgatgtgaaggcggaggcc
gctggcccctcctgggcgcgcgccgactggccgcctgcccccaatgatgatctgactggc
gcgctgacgggcgagtggccggccccggcagaggccaagggtgctggcaagaagatcaag
gaccaggccgctgccaagggcgttgaagtcaccgatgatcaggtccagcgcgctgtgctg
gattcgatccgggccctgatgctgatccgggcctaccggatccgtggccatctggccgcc
aatctcgaccccctcggtatgcgcgaggaggcccagcatcccgagctggatccgcgcacc
tatggcttcaccgaagcggacatggaccgcccgatcttcatcgacaatgttctggggctt
caggtcgcctcgatgcgtcagatcgtcagcatcgtgaaacggacctattgcggcaccttt
gcgctacagtacatgcatatctccgatcccgaacaggccagctggctgaaggagcggatc
gagggctatgacaaagaaatccgctttacccgcgagggccgcaaggcgatcctcaacaaa
atggttgaggcagagggtttcgagaaattcctgcacgtcaaatacatgggcacgaagcgc
ttcggtctggacggtggcgagagccttattccggcaatggagcagatcatcaagcgcggt
ggcgcgctggggatccgtgatatcgtcatcggcatgccacaccgcggacgcctatcggtg
ctcgccaatgtgatgcagaagccatacaaggcgattttcaacgaatttcagggcggcagc
ttcaagcccgaagatgttgatggatcgggagatgtaaaatatcacctcggcgcctcttcc
gaccgtgaattcgacggcaacaccgttcacttgtccttgactgcgaacccctcccacctt
gaggccgtgaacccggttgttcttggcaaagttcgcgcaaagcaggatcagctcaaggac
agcgagcgcaccaaggtgctgccgatcctcttgcacggtgacgcagcctttgcaggccaa
ggcgttgtggccgaatgcttcgccctctccggcctgcgcggtcacaaggccggcggcact
atgcatatcgtggtgaacaaccagatcggttttaccacggcaccgcatttctcgcgctct
tcgccttaccccaccgacaacgcgttggtggtcgaggcgccgatcttccacgtcaacggt
gacgatccggaagcggtggttcacgccgccagggtcgccacggaattccgccagaaattc
cacaaggatgtcgttctcgatatcttctgctaccgccggtttggccataacgagggcgac
gagcccatgttcaccaacccgctaatgtacaagaagatcaagggccacaaaacaaccctg
tcgctttataccgagcgtctggtgaaggatggcctgatccccgagggtgagatcgaggat
atgaaagcctcgttccaagcccgattgaatgaggaattcgaagccggtaaaaacttcaag
ccgaacaaggcggactggctggatggccgctggtcccacctcgacaaaaaggacaccgat
taccagcgcggccagacctctgtgtcgcccgagacgttcaaagaggtcggcaccgctctc
agccgtgtgcccgagggatttccagtccacaaaaccatcggccgtttcctagacgcacgt
gccaagatggtggacagcggcgaggggatcgattgggcaaccggggaggcgctcgccttt
ggctctcttctgactgagggctatccggtgcgtctgtccggacaggatgccacccgtggt
acattctcccagcgtcattccggcatcgtcaatcagaacaccgaggaacgatactatccg
ctcaacaatatccgcagcgggcaatcccactatgaggtgatcgactcggccctcagcgag
tatgctgtgctgggcttcgagtatggctattcactcgccgaacccaatgcactgacgctc
tgggaagcgcagttcggtgatttcgccaatggtgcgcagatcatgttcgatcagttcatc
tcctccggcgaaagcaaatggctgcggatgtccggcttggtctgcctgctgccgcacggg
tttgagggccaggggccggagcactcctccgcgcgcctcgaacgcttcctgcagatgtgt
ggtcaagacaactggatcgtggcgaattgcacaacaccggcgaactacttccacatcctg
cgccgccagctgcaccgtaccttccgcaagccgctgattttggtcacgccgaaatcgctg
ctgcgccacaaattggccgtgtccaaggcagaagagttcaccaccggttcgtccttccac
cgtgtgctgtgggatgacgcccagcatggcaattccgacaccaagctggtcgccgatgac
aaaatcaagcgcgtcgttctctgctcgggcaaggtttactatgaccttctggaagaacgc
gacgcccgtgggctcgacgatgtatatctgatgcggattgaacaatattatccgttccct
gctatctcccttgtgaaggagcttgagcgcttcaaaggtgctgaggtggtctggtgtcag
gaggagcccaaaaatcagggcgcctggagcttcatcgagcccaatatcgaatgggtgctg
acgcgcatcggcgccaagcacagccgcccgacctatgtcggtcgcgccacctcggcttcg
cccgcaacgggcctggccagcgaacacaaagcccaacaagctgcgctcgtgaacgaagcg
ctgagcatcgaaggataa

DBGET integrated database retrieval system