KEGG   Phaeobacter piscinae: PhaeoP14_02252Help
Entry
PhaeoP14_02252    CDS       T05105                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase Tdk
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ppic  Phaeobacter piscinae
Pathway
ppic00240  Pyrimidine metabolism
ppic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    PhaeoP14_02252 (tdk)
Enzymes [BR:ppic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     PhaeoP14_02252 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: ATG40331
LinkDB All DBs
Position
2379369..2379968
Genome map
AA seq 199 aa AA seqDB search
MAKLYFHYSTMNAGKSTVLLQASHNYRENNMDTYLLTAALDDRAGQGRIASRIGIGAEAD
MFRPGENLFDKVANRLAKGPVASIFVDEAQFLSPDQVWDLARVVDDLRVPVLCYGLRVDF
QGKLFPGSATLLALADEMREVRTICHCGKKATMVIRQDDQGRTITEGAQVQIGGNETYVS
LCRRHWRQATGDLPAEASD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctttactttcattactccaccatgaatgccggcaaatcgacggtgctcttg
caagcctcgcataactaccgcgagaacaatatggacacctatctgctgactgcggcgttg
gatgaccgcgccggtcaggggcggattgcctcccgcatcgggatcggcgccgaggcggat
atgtttcgccccggcgagaacctgtttgacaaggtcgccaaccgtctggccaagggcccg
gtcgccagtatctttgtcgatgaggcgcagtttctgtcgccggatcaggtctgggatctg
gcacgggtggtggatgatctgcgggtgccggtgctgtgctacgggctcagggtcgatttt
cagggcaagctgtttccgggatcggcgacactgctggcgctggctgatgaaatgcgcgag
gtgcgcaccatctgtcactgcggcaagaaggcgaccatggtgatccggcaggatgatcag
gggcggaccatcaccgaaggggcccaggtacagatcggcggcaatgaaacatatgtgtcg
ctctgccgtcgccactggcgacaggccacgggtgacctgcctgcggaggcgtctgactga

DBGET integrated database retrieval system