KEGG   Phaeobacter piscinae: PhaeoP14_03160Help
Entry
PhaeoP14_03160    CDS       T05105                                 

Definition
(GenBank) Adenylate cyclase, family 3 (some protein containing HAMP domain protein)
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
ppic  Phaeobacter piscinae
Pathway
ppic00230  Purine metabolism
ppic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PhaeoP14_03160
Enzymes [BR:ppic01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     PhaeoP14_03160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transf_9 Guanylate_cyc
Motif
Other DBs
NCBI-ProteinID: ATG41201
LinkDB All DBs
Position
3302099..3303715
Genome map
AA seq 538 aa AA seqDB search
MAPMLANQQETTLMNLRANTAPQPYGILIEELRGPVTARLGGKIIAQSTRAKVMYETRQP
AAIYFPRNDIHSCLSAANGHQTFCPFKGTAGYQDLQLGKHCIGNAAWSYDEALPEASGIA
GHVSFMPDANVDIDLGSNQLVIPDYGNISGPLIDWLLREAAYLPTPEEFTQRLSEKLVEQ
GVHLSRLSVMAWSLHPMIAGKNFIWSRASGKVTTYAPSYEIHDHPAFQNSPLRHVSNGLG
GIRQRLDLEQPSDAFPILTDLREEGATDYVAMPLPFSDGRINVLTVASHHPKGFTTENLG
LIFECSAVIARYYEVFMQRENAQSLLETYVGKRTGARVLGGEIRRGDGDDIDAAIMFCDL
RGSTRLEEELGRTAYIELLNNFFETASTIVHDHGGEVLKFIGDAVLAVFPAGDSPAEARA
QALQSARAIVAALDAMGDDPGQRRSECSIGLAYGGVTYGNVGSRERLDFTVIGQAANIAA
RLGDYGKSCGHTIVVSRDLLETPEQATPLGSVSLHNVSRPVEAFAVSMAIDPGQRASG
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcccccatgctggccaatcagcaggaaacgacgcttatgaatttgcgcgcaaatacc
gctccgcagccctatggcatcctgattgaagagctgcgcgggccggtgaccgcgcgcctc
ggtgggaaaatcatcgcgcaaagcacccgcgccaaggtgatgtatgaaacccgccagcct
gccgcgatttatttccctcgcaatgatatccactcctgcctatctgcagccaatggtcac
cagactttctgccccttcaagggcacagcgggctatcaggatcttcagcttggcaaacac
tgtattggcaatgccgcctggtcttacgacgaagccttgcctgaggcctccggaattgca
ggtcatgtcagtttcatgccggacgccaacgtcgacatcgacctgggcagcaatcagctg
gtcatccccgactacggcaatatctccggccccctgatcgactggctgctgcgtgaggca
gcctatttgcccacaccggaggagtttacccagcgcctttccgaaaaactggtggaacaa
ggcgttcatctatctcgcctttcggtgatggcctggtctttgcatcctatgatcgcgggc
aagaacttcatctggagccgcgcatcaggcaaggtgaccacctatgcgcctagctatgag
atccacgaccacccggccttccagaacagccccttgcgccacgtctcgaatgggctgggc
ggaattcgtcaacgtctggatctggaacagcccagcgacgcgtttcccatcctgaccgac
ctgcgagaggagggcgcgacggactatgtggccatgccgcttccgttttcggatgggcgc
atcaatgtgctgactgttgccagccaccaccccaaaggtttcacgactgagaacttgggg
ctgatatttgaatgctccgcagtgatcgcgcgctactacgaagtgttcatgcaacgcgaa
aacgcccagtccctgctggagacctatgtcggcaaacgcaccggcgcgcgggttctgggc
ggagagatccggcgcggcgatggcgacgatattgatgcggccatcatgttctgcgacctg
cgcggttcgacccgtctggaagaggagctgggccgcaccgcctatatcgaactgctcaac
aatttctttgagacggcatccaccatcgtgcacgaccacgggggcgaagtgctgaaattc
atcggagacgctgttctggccgtgttcccggcgggtgacagcccggctgaggcacgcgct
caggcgctgcagtcagcgcgcgccatcgttgccgcgctggacgccatgggcgacgatccc
ggccagaggcgcagcgaatgctccatcggtctggcctatggcggcgtcacctatggcaac
gtcggctcgcgtgagcggctggacttcaccgtcatcggacaggccgcaaatatcgcggca
cggctcggcgactatggcaaatcctgtggccataccattgtggtcagccgagacttgctg
gagacaccggaacaagccacgccgctggggtctgtgtcactgcacaacgtctcacgcccc
gtagaggccttcgccgtgtccatggccatcgacccaggccagcgtgctagcggctga

DBGET integrated database retrieval system