KEGG   Pseudoalteromonas piscicida: B1L02_02935Help
Entry
B1L02_02935       CDS       T04942                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ppis  Pseudoalteromonas piscicida
Pathway
ppis03030  DNA replication
ppis03410  Base excision repair
ppis03420  Nucleotide excision repair
ppis03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ppis00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    B1L02_02935
   03410 Base excision repair
    B1L02_02935
   03420 Nucleotide excision repair
    B1L02_02935
   03430 Mismatch repair
    B1L02_02935
Enzymes [BR:ppis01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     B1L02_02935
    6.5.1.6  DNA ligase (ATP or NAD+)
     B1L02_02935
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     B1L02_02935
DNA replication proteins [BR:ppis03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    B1L02_02935
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     B1L02_02935
DNA repair and recombination proteins [BR:ppis03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     B1L02_02935
   NER (nucleotide excision repair)
    Other NER factors
     B1L02_02935
   MMR (mismatch exicision repair)
    Other MMR factors
     B1L02_02935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ASD66094
UniProt: A0A1Z3NF55
LinkDB All DBs
Position
1:620877..621716
Genome map
AA seq 279 aa AA seqDB search
MRYLPCLLCLLLCFSNFLYGNETHTKIQLASVYQGDEDISNYLVSEKFDGVRAIWDGSQL
RTRGGHLIKAPDWFTQGLPETWLDGELWAGYNNFAFVSAIARRHLPNNEHWRQVTYYVFD
APNSAEIFSKRHERYLSLLSHIELSHIKPVKQLSFGSVKALNDYYHAVLKRGGEGVILHA
KNAKHEDGRTTNVLKYKPYLDDEAIVIKHLPGKGKYQGMMGSLLVRDEQGMEFKIGSGFS
DEERASPPPIGSQITYRYQGYTKFGKPRFARFLRVRPKL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatttaccatgcttattatgtctactactgtgtttttccaatttcctttatggg
aatgaaacccacacaaaaatccagcttgcttccgtatatcaaggcgacgaagatatttct
aattaccttgttagtgaaaaatttgatggtgttagggccatttgggatggctcacagctg
cgtacgcgtggcggtcatttaattaaggcgcctgactggtttacgcaagggctacctgag
acatggttagacggcgagttgtgggctgggtacaataacttcgcttttgtgagcgcgatt
gcgaggcgccatttgcctaacaatgagcactggcgtcaagtgacttattatgtatttgac
gcgccaaattctgcagagatattctccaaacgtcatgagcgttacttaagcctactaagc
catattgagttatcgcacattaaacccgtcaagcagctatcatttggctccgttaaggcg
ttaaacgattattatcatgctgtcttaaagcgaggcggtgaaggggttattttgcatgct
aaaaatgccaagcacgaagatggaagaacaaccaacgtattaaaatacaagccgtatctt
gacgacgaagccatcgtgattaagcatttacccggtaagggaaagtaccaagggatgatg
ggatcgctactggtgagagatgaacaaggtatggagtttaaaattggctcggggtttagc
gacgaagagcgcgcatcaccaccaccgattggtagtcaaattacctatcgataccaagga
tatactaagtttggtaaaccgcgttttgcgcgatttttaagagtaaggccaaaattatag

DBGET integrated database retrieval system