KEGG   Pseudoalteromonas piscicida: B1L02_06350Help
Entry
B1L02_06350       CDS       T04942                                 

Gene name
folP
Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
ppis  Pseudoalteromonas piscicida
Pathway
ppis00790  Folate biosynthesis
ppis01100  Metabolic pathways
Module
ppis_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppis00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B1L02_06350 (folP)
Enzymes [BR:ppis01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     B1L02_06350 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind RPW8 Amidohydro_2 PAP_central
Motif
Other DBs
NCBI-ProteinID: ASD66675
LinkDB All DBs
Position
1:1330692..1331537
Genome map
AA seq 281 aa AA seqDB search
MYELRLPKGRTLSLDKPQVMGILNVTPDSFSDGGHFTHLDSALEQANLMLSQGATILDIG
GESTRPGAPNVQLEEELQRVIPIIKAIRTHSNCVISVDTSKAEVMKQAIEAGADIINDVR
ALQGSGALEVAAQYPDVPICLMHMQGEPRSMQNNPHYDDLFSDISQFFEARISACKQAGI
DTNRLILDPGFGFGKSLEHNFQILGGLDKFYAFDLPILTGLSRKSMFGQLLTRETHERVA
ASLAGALICAQQGAHIIRVHDVKETSDVLNVWLASVNGVTQ
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagttacgtttacccaaagggcgcacccttagtttagataagcctcaagtaatg
gggattttaaatgttactcctgactcattttctgacggtggacattttactcaccttgat
agtgcgctcgaacaagcaaatttaatgctttcacaaggcgctaccatcttagacatcggt
ggagagtcaactcgtcccggtgcaccaaacgtgcaattagaagaagaattacagcgcgta
ataccgatcataaaagcaattcgcacacactcgaactgtgtgatttcggtagataccagt
aaagccgaggtgatgaaacaagcaatagaggctggcgctgatatcattaatgatgttcgg
gcattgcaaggatctggcgcgttggaagtcgcagcccaatatcccgatgtaccaatttgt
ttaatgcatatgcagggcgaacctcgctcaatgcaaaataaccctcactatgatgactta
ttttcagacatcagtcagtttttcgaagctaggatcagtgcgtgcaagcaagctgggatt
gataccaatcggctgattttagatcctggttttggcttcggtaaatctctagagcataac
tttcagatattaggtggattggacaagttttacgctttcgatttgcctattctgacaggc
ctctctagaaagtccatgtttggacaactactcactcgggaaacgcatgagcgcgtggct
gcgagcctagccggtgcactgatatgtgcgcagcaaggcgcacatataattcgtgttcat
gacgtaaaagaaacaagcgacgtccttaatgtatggctggcgtcggtcaatggagttact
caatga

DBGET integrated database retrieval system